FC929412

Overview
NameFC929412
Unique NameFC929412
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length779
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929412_ssr53 microsatellite FC929412_ssr53:53..64. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig11040 contig Ccv1_Contig11040:209..987. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: MO25N_ARATH (Putative MO25-like protein At5g47540 OS=Arabidopsis thaliana GN=At5g47540 PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.086e-89
Identity = 162/198 (81.82%), Postives = 186/198 (93.94%), Query Frame = 2
Query:  194 MKGLFKSKPRTPVDIVRQTRDLIIYANRSA---DVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            MKGLFKSKPRTP D+VRQTRDL+++++RS    D+R+SKR++KMAEL +NIR++KSILYGNSE+EPV+EACAQLT EFF+E+TLRLLITCLPKLNLE RKDATQVVANLQRQQV+S+LIASDYLEANIDL+D+LI G+ENTDMALHYGAM RECIRHQ VA+YVLES H+KKFFDYIQLPNFDIAADAAATFKELLTR
Sbjct:    1 MKGLFKSKPRTPADLVRQTRDLLLFSDRSTSLPDLRDSKRDEKMAELSRNIRDMKSILYGNSEAEPVAEACAQLTQEFFKEDTLRLLITCLPKLNLETRKDATQVVANLQRQQVNSRLIASDYLEANIDLMDVLIEGFENTDMALHYGAMFRECIRHQIVAKYVLESDHVKKFFDYIQLPNFDIAADAAATFKELLTR 198          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: MO25M_ARATH (Putative MO25-like protein At4g17270 OS=Arabidopsis thaliana GN=At4g17270 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 5.219e-84
Identity = 155/198 (78.28%), Postives = 179/198 (90.40%), Query Frame = 2
Query:  194 MKGLFKSKPRTPVDIVRQTRDLIIYANRS---ADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            M+GLFKSKPRTP DIVRQTRDL++YA+RS    D+RESKRE+KM EL K+IR+LK ILYGNSE+EPV+EACAQLT EFF+ +TLR L+T LP LNLEARKDATQVVANLQRQQV+S+LIA+DYLE+NIDL+D L+ G+ENTDMALHYG M RECIRHQ VA+YVL+S+H+KKFF YIQLPNFDIAADAAATFKELLTR
Sbjct:    1 MRGLFKSKPRTPADIVRQTRDLLLYADRSNSFPDLRESKREEKMVELSKSIRDLKLILYGNSEAEPVAEACAQLTQEFFKADTLRRLLTSLPNLNLEARKDATQVVANLQRQQVNSRLIAADYLESNIDLMDFLVDGFENTDMALHYGTMFRECIRHQIVAKYVLDSEHVKKFFYYIQLPNFDIAADAAATFKELLTR 198          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: MO25L_ARATH (MO25-like protein At2g03410 OS=Arabidopsis thaliana GN=At2g03410 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.087e-65
Identity = 124/199 (62.31%), Postives = 158/199 (79.40%), Query Frame = 2
Query:  194 MKGLFKSKPRTPVDIVRQTRDLIIYAN---RSADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENT-DMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            MKGLFK+K R P +IVRQTRDLI  A       D R SKR    AELC+NIR+LKSILYGN E+EPV EAC  LT EFFR +TLR LI  +PKL+LEARKDATQ+VANLQ+QQV  +L+AS+YLE+N+D++D L+ G ++  ++ALHY  ML+EC+RHQ VA+Y+LES++++KFFDY+QLP FD+A DA+  F+ELLTR
Sbjct:    1 MKGLFKNKSRLPGEIVRQTRDLIALAESEEEETDARNSKRLGICAELCRNIRDLKSILYGNGEAEPVPEACLLLTQEFFRADTLRPLIKSIPKLDLEARKDATQIVANLQKQQVEFRLVASEYLESNLDVIDSLVEGIDHDHELALHYTGMLKECVRHQVVAKYILESKNLEKFFDYVQLPYFDVATDASKIFRELLTR 199          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: CAB39_HUMAN (Calcium-binding protein 39 OS=Homo sapiens GN=CAB39 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.954e-34
Identity = 72/191 (37.70%), Postives = 117/191 (61.26%), Query Frame = 2
Query:  206 FKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            F    ++P DIV+  ++ +    +  D+ + K E    E+ KN+  +K ILYG +E EP +EA AQL  E +    L  L+  L  ++ E +KD  Q+  N+ R+Q+ ++    +Y+    ++L +L+ GYE+ ++AL+ G MLRECIRH+ +A+ +L S+    FF Y+++  FDIA+DA ATFK+LLTR
Sbjct:    5 FGKSHKSPADIVKNLKESMAVLEKQ-DISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTR 194          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: CAB39_BOVIN (Calcium-binding protein 39 OS=Bos taurus GN=CAB39 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.954e-34
Identity = 72/191 (37.70%), Postives = 117/191 (61.26%), Query Frame = 2
Query:  206 FKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            F    ++P DIV+  ++ +    +  D+ + K E    E+ KN+  +K ILYG +E EP +EA AQL  E +    L  L+  L  ++ E +KD  Q+  N+ R+Q+ ++    +Y+    ++L +L+ GYE+ ++AL+ G MLRECIRH+ +A+ +L S+    FF Y+++  FDIA+DA ATFK+LLTR
Sbjct:    5 FGKSHKSPADIVKNLKESMAVLEKQ-DISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTR 194          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: CAB39_MOUSE (Calcium-binding protein 39 OS=Mus musculus GN=Cab39 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.470e-34
Identity = 72/191 (37.70%), Postives = 117/191 (61.26%), Query Frame = 2
Query:  206 FKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            F    ++P DIV+  ++ +    +  D+ + K E    E+ KN+  +K ILYG +E EP +EA AQL  E +    L  L+  L  ++ E +KD  Q+  N+ R+Q+ ++    +Y+    ++L +L+ GYE+ ++AL+ G MLRECIRH+ +A+ +L S+    FF Y+++  FDIA+DA ATFK+LLTR
Sbjct:    5 FGKSHKSPADIVKNLKESMAVLEKQ-DISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTR 194          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: MO25M_CAEEL (MO25-like protein 2 OS=Caenorhabditis elegans GN=mop-25.2 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.193e-33
Identity = 75/196 (38.27%), Postives = 116/196 (59.18%), Query Frame = 2
Query:  194 MKGLFKSKPRTPVDIVRQTRDLIIYANR-SADVRESKREDKMAELCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            +K LF    +TP D+V+  RD ++  +R   +  E K E  + E  K +   K+ +YG+  +EP +E   QL  E +  N L +LI  L K   E +KD   V  NL R+Q+ ++    +YL A  ++L  L+ GYE  D+AL  G+MLRE +RH+ +AR VL S++ ++FF ++Q   FDIA DA +TFK+L+T+
Sbjct:    2 LKPLFGKADKTPADVVKNLRDALLVIDRHGTNTSERKVEKAIEETAKMLALAKTFIYGSDANEPNNEQVTQLAQEVYNANVLPMLIKHLHKFEFECKKDVASVFNNLLRRQIGTRSPTVEYLAARPEILITLLLGYEQPDIALTCGSMLREAVRHEHLARIVLYSEYFQRFFVFVQSDVFDIATDAFSTFKDLMTK 197          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: CB39L_HUMAN (Calcium-binding protein 39-like OS=Homo sapiens GN=CAB39L PE=1 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 5.477e-33
Identity = 77/197 (39.09%), Postives = 119/197 (60.41%), Query Frame = 2
Query:  191 KMKGLFKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAE-LCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            K   LF    + P +IV+  +D     N +   ++ K+ DK +E + K+++ +K IL G +E EP +EA AQL  E +    L  LI  L  ++ E +KD TQ+  N+ R+Q+ ++    +Y+ A+  +L +L+ GYE   +AL  G MLRECIRH+ +A+ +L S   + FF Y++L  FDIA+DA ATFK+LLTR
Sbjct:    2 KKMPLFSKSHKNPAEIVKILKD-----NLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTR 193          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: CB39L_MOUSE (Calcium-binding protein 39-like OS=Mus musculus GN=Cab39l PE=1 SV=3)

HSP 1 Score: 139.428 bits (350), Expect = 2.081e-32
Identity = 75/197 (38.07%), Postives = 119/197 (60.41%), Query Frame = 2
Query:  191 KMKGLFKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAE-LCKNIRELKSILYGNSESEPVSEACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENTDMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            K   LF    + P +IV+  +D     N +   ++ K+ DK +E + K+++ +K IL G ++ EP +EA AQL  E +    L  LI  L  ++ E +KD TQ+  N+ R+Q+ ++    +Y+ ++  +L +L+ GYE   +AL  G MLRECIRH+ +A+ +L S   + FF Y++L  FDIA+DA ATFK+LLTR
Sbjct:    2 KKMPLFSKSHKNPAEIVKILKD-----NLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNDKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYISSHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTR 193          
BLAST of FC929412 vs. ExPASy Swiss-Prot
Match: MO25_DROME (Protein Mo25 OS=Drosophila melanogaster GN=Mo25 PE=2 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 3.674e-29
Identity = 69/195 (35.38%), Postives = 122/195 (62.56%), Query Frame = 2
Query:  203 LFKSKPRTPVDIVRQTRDLIIYANRSADVRESKREDKMAELCKNIRELKSILYGNSESEPVSE-ACAQLTAEFFRENTLRLLITCLPKLNLEARKDATQVVANLQRQQVHSKLIASDYLEANIDLLDILIAGYENT--DMALHYGAMLRECIRHQSVARYVLESQHMKKFFDYIQLPNFDIAADAAATFKELLTR 778
            LF    ++PV++V+  ++ I     + +  + K E    ++ KN+  +K++LYG+S++EP ++   AQL+ E +  N L LLI  L +++ E +K    +  N+ R+Q+ ++    +Y+    ++L  L+AGYE+   ++AL+ G MLREC R++++A+ +L S    KFF Y+++  FDIA+DA +TFKELLTR
Sbjct:    3 LFGKSQKSPVELVKSLKEAI----NALEAGDRKVEKAQEDVSKNLVSIKNMLYGSSDAEPPADYVVAQLSQELYNSNLLLLLIQNLHRIDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTR 193          
The following BLAST results are available for this feature:
BLAST of FC929412 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
MO25N_ARATH1.086e-8981.82Putative MO25-like protein At5g47540 OS=Arabidopsi... [more]
MO25M_ARATH5.219e-8478.28Putative MO25-like protein At4g17270 OS=Arabidopsi... [more]
MO25L_ARATH7.087e-6562.31MO25-like protein At2g03410 OS=Arabidopsis thalian... [more]
CAB39_HUMAN4.954e-3437.70Calcium-binding protein 39 OS=Homo sapiens GN=CAB3... [more]
CAB39_BOVIN4.954e-3437.70Calcium-binding protein 39 OS=Bos taurus GN=CAB39 ... [more]
CAB39_MOUSE6.470e-3437.70Calcium-binding protein 39 OS=Mus musculus GN=Cab3... [more]
MO25M_CAEEL4.193e-3338.27MO25-like protein 2 OS=Caenorhabditis elegans GN=m... [more]
CB39L_HUMAN5.477e-3339.09Calcium-binding protein 39-like OS=Homo sapiens GN... [more]
CB39L_MOUSE2.081e-3238.07Calcium-binding protein 39-like OS=Mus musculus GN... [more]
MO25_DROME3.674e-2935.38Protein Mo25 OS=Drosophila melanogaster GN=Mo25 PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BG10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BG10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929412 ID=FC929412|Name=FC929412|organism=Citrus clementina|type=EST|length=779bp
ACAACTCAGACAGCAAAATTAAATTCGAAAGCTGAAACCCTAAAGCCTAA
TTAGAAGAAGAAGATACACAATAGGAATCTGTGCGTCAAAGCCGAAAGCT
GAGGCGCTCTCAGCCTCGGCGAGTCAATCGGTCCAGCGCCTCTCGAGCTC
AGCCAGTTCAAGTTCGATTAACGAATTAGACCCTAACACAAAAATGAAGG
GACTTTTCAAATCCAAGCCTCGTACTCCCGTCGACATCGTCCGCCAAACT
CGGGATCTTATTATTTACGCCAATCGCAGCGCAGATGTTCGTGAATCGAA
GCGCGAAGACAAGATGGCAGAGTTATGTAAAAACATCAGGGAGTTAAAGT
CAATACTTTATGGCAATAGTGAATCTGAGCCAGTTTCAGAGGCATGTGCA
CAATTGACTGCAGAGTTCTTCAGGGAAAACACGTTACGGCTTTTGATAAC
TTGTCTTCCAAAGTTGAACTTGGAGGCAAGGAAAGATGCCACTCAGGTTG
TTGCTAATTTACAGAGGCAACAAGTTCACTCAAAGTTGATTGCCTCTGAC
TACTTAGAAGCAAACATAGATCTTTTGGATATTCTGATAGCTGGTTATGA
AAACACAGACATGGCTTTACATTATGGTGCTATGCTTAGGGAGTGTATTC
GTCATCAGAGTGTTGCAAGATATGTGTTGGAATCCCAGCACATGAAGAAG
TTTTTTGACTATATACAGCTTCCAAATTTTGACATTGCTGCAGATGCTGC
TGCAACTTTTAAGGAACTGTTGACAAGGC
back to top