FC929413

Overview
NameFC929413
Unique NameFC929413
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length533
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12114 contig Ccv1_Contig12114:965..1497. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC21_MEDSA (Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.829e-32
Identity = 59/74 (79.73%), Postives = 70/74 (94.59%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNEDTWPGVTSLPDFKS FP+WPSK+L TVV NLEPAG+DLL+ MLC+DP++RITARSA+EHEYF+D++FVP
Sbjct:  218 GTPNEDTWPGVTSLPDFKSTFPRWPSKDLATVVPNLEPAGLDLLNSMLCLDPTKRITARSAVEHEYFKDIKFVP 291          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2_CHERU (Cell division control protein 2 homolog OS=Chenopodium rubrum GN=CDC2 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.221e-31
Identity = 59/74 (79.73%), Postives = 69/74 (93.24%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNE+TWPGVTSLPDFKS+FPKW SK+L  VV NL+PAGIDLL+KMLC+DPS+RITAR+ALEHEYF+D+ FVP
Sbjct:  221 GTPNEETWPGVTSLPDFKSSFPKWISKDLSAVVPNLDPAGIDLLNKMLCLDPSKRITARNALEHEYFKDIGFVP 294          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC22_MEDSA (Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.323e-29
Identity = 57/74 (77.03%), Postives = 66/74 (89.19%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNE+TWPGVTSLPDFKSAFPKWP+K+L T V NLEPAG+DLLS    +DP+RRITAR ALEHEYF+D++FVP
Sbjct:  221 GTPNEETWPGVTSLPDFKSAFPKWPAKDLATQVPNLEPAGLDLLSSTCRLDPTRRITARGALEHEYFKDIKFVP 294          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2_VIGAC (Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.034e-29
Identity = 55/74 (74.32%), Postives = 67/74 (90.54%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNE+TWPGVT+LPDFKS FPKWP K+L TVV NL+ AG++LLS MLC+DPS+RITAR A+EHEYF+D++FVP
Sbjct:  221 GTPNEETWPGVTALPDFKSTFPKWPPKDLATVVPNLDAAGLNLLSSMLCLDPSKRITARIAVEHEYFKDIKFVP 294          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2A_ANTMA (Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 5.175e-29
Identity = 56/74 (75.68%), Postives = 67/74 (90.54%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNE+TWPGVTSLPDFKSAFPKWP+KEL  VV NL+ +G+DLL KML +DPS+RITAR+AL+HEYF+D+ FVP
Sbjct:  221 GTPNEETWPGVTSLPDFKSAFPKWPAKELAAVVPNLDASGLDLLDKMLRLDPSKRITARNALQHEYFKDIGFVP 294          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2_VIGUN (Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 9.760e-28
Identity = 53/74 (71.62%), Postives = 66/74 (89.19%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFVP 229
            GTPNE+TWPGVT+LPDFKS FPKWP K+L T+V NL+ AG++LLS ML +DPS+RITAR A+EHEYF+D++FVP
Sbjct:  221 GTPNEETWPGVTALPDFKSTFPKWPPKDLATMVPNLDAAGLNLLSSMLSLDPSKRITARIAVEHEYFKDIKFVP 294          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2B_ANTMA (Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.101e-26
Identity = 52/70 (74.29%), Postives = 60/70 (85.71%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDV 217
            GTPNED WPGVTSLPDFKS+FPKWP KEL T+V NL   G+DLL KML +DPS+RITA+ ALEHEYF+D+
Sbjct:  208 GTPNEDIWPGVTSLPDFKSSFPKWPPKELATIVPNLGATGLDLLCKMLQLDPSKRITAKKALEHEYFKDI 277          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDC2_MAIZE (Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.558e-25
Identity = 51/73 (69.86%), Postives = 64/73 (87.67%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFV 226
            GTPNE +WPGV+ LPDFK+AFP+W +++L TVV NL+PAG+DLLSKML  +PS+RITAR ALEHEYF+D+E V
Sbjct:  221 GTPNEQSWPGVSCLPDFKTAFPRWQAQDLATVVPNLDPAGLDLLSKMLRYEPSKRITARQALEHEYFKDLEVV 293          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDKA1_ORYSJ (Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.035e-25
Identity = 50/73 (68.49%), Postives = 64/73 (87.67%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVEFV 226
            GTPNE +WPGV+SLPD+KSAFPKW +++L T+V  L+PAG+DLLSKML  +P++RITAR ALEHEYF+D+E V
Sbjct:  221 GTPNEQSWPGVSSLPDYKSAFPKWQAQDLATIVPTLDPAGLDLLSKMLRYEPNKRITARQALEHEYFKDLEMV 293          
BLAST of FC929413 vs. ExPASy Swiss-Prot
Match: CDKA2_ORYSJ (Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.319e-24
Identity = 50/71 (70.42%), Postives = 61/71 (85.92%), Query Frame = 2
Query:    8 GTPNEDTWPGVTSLPDFKSAFPKWPSKELGTVVRNLEPAGIDLLSKMLCMDPSRRITARSALEHEYFRDVE 220
            GTPNE+TWPGV SLPD+ S FPKWPS +L TVV  L+ +G+DLLSKML +DPS+RI AR+ALEHEYF+D+E
Sbjct:  220 GTPNEETWPGVASLPDYISTFPKWPSVDLATVVPTLDSSGLDLLSKMLRLDPSKRINARAALEHEYFKDLE 290          
The following BLAST results are available for this feature:
BLAST of FC929413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CDC21_MEDSA3.829e-3279.73Cell division control protein 2 homolog 1 (Fragmen... [more]
CDC2_CHERU7.221e-3179.73Cell division control protein 2 homolog OS=Chenopo... [more]
CDC22_MEDSA2.323e-2977.03Cell division control protein 2 homolog 2 OS=Medic... [more]
CDC2_VIGAC3.034e-2974.32Cell division control protein 2 homolog OS=Vigna a... [more]
CDC2A_ANTMA5.175e-2975.68Cell division control protein 2 homolog A OS=Antir... [more]
CDC2_VIGUN9.760e-2871.62Cell division control protein 2 homolog OS=Vigna u... [more]
CDC2B_ANTMA4.101e-2674.29Cell division control protein 2 homolog B (Fragmen... [more]
CDC2_MAIZE1.558e-2569.86Cell division control protein 2 homolog OS=Zea may... [more]
CDKA1_ORYSJ2.035e-2568.49Cyclin-dependent kinase A-1 OS=Oryza sativa subsp.... [more]
CDKA2_ORYSJ1.319e-2470.42Cyclin-dependent kinase A-2 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BH01RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BH01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929413 ID=FC929413|Name=FC929413|organism=Citrus clementina|type=EST|length=533bp
GGCACGAGGAACACCTAATGAGGACACATGGCCTGGAGTGACTTCATTGC
CTGACTTTAAATCTGCCTTTCCTAAATGGCCTTCTAAGGAGTTGGGGACT
GTTGTTCGAAATCTTGAGCCAGCTGGCATTGATCTCCTTTCTAAAATGCT
CTGCATGGATCCAAGCAGAAGAATTACTGCCAGAAGTGCTCTAGAACATG
AATACTTCAGGGACGTCGAATTTGTACCCTAATATCTGTTGTATATGCTA
TTAGAGTGTTGACATTATTGTGAAGCCTTCGGTTTTGATTGTTTGCGAAA
TTTGCCGACTGTCTTTACTTGCAGTTTTACTGAAAAGTCTTACTACATGG
AATGGCTTTTTACAGTCATCTCTGGATTTGCCTAGTTTGTAATCGTGTAT
TCGCGGCTTTCTTGATCTTGTGGATAAATGTTTGTGCCAGTTTTTCTTTT
AATATTTGATATGTAATACACCAAATTGAATTTGTTGTTCGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top