FC929414

Overview
NameFC929414
Unique NameFC929414
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length512
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1879 contig Ccv1_Contig1879:386..897. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL117_ARATH (Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.821e-33
Identity = 70/105 (66.67%), Postives = 84/105 (80.00%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 325
            EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:  117 EILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL115_ARATH (Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.821e-33
Identity = 70/105 (66.67%), Postives = 84/105 (80.00%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 325
            EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:  117 EILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL114_ARATH (Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.821e-33
Identity = 70/105 (66.67%), Postives = 84/105 (80.00%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 325
            EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:  118 EILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 222          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL119_ARATH (Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 9.039e-33
Identity = 69/105 (65.71%), Postives = 83/105 (79.05%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 325
            EI +++EGTLYVGFV+S+Q NN L AKVLN GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIAD VFG+ P INPD L +AFQLD  +VKDL+ KF N
Sbjct:  117 EILVLVEGTLYVGFVSSNQDNNRLFAKVLNPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADIVFGSTPPINPDILAQAFQLDVNVVKDLEAKFKN 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL113_ARATH (Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 9.039e-33
Identity = 70/105 (66.67%), Postives = 83/105 (79.05%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFIN 325
            EI +++EGTLYVGFV+S+Q NN L AKVL  GDVFVFP G+IHFQ NIGKT A A++ L+SQ  G +TIADTVFG+ P INPD L +AFQLD  IVKDL+ KF N
Sbjct:  118 EILVLIEGTLYVGFVSSNQDNNRLFAKVLYPGDVFVFPIGMIHFQVNIGKTPAVAFAGLSSQNAGVITIADTVFGSTPPINPDILAQAFQLDVNIVKDLEAKFRN 222          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL111_ARATH (Germin-like protein subfamily 1 member 11 OS=Arabidopsis thaliana GN=At5g38940 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.630e-32
Identity = 69/103 (66.99%), Postives = 85/103 (82.52%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 319
            EI +V +GTL VGFVTS+  +N L +KVLN+GDVFVFP+GLIHFQ NIGK  A A++AL+SQ PG +TIA+TVFGANP+INP  L KAFQL+P++V DLQ KF
Sbjct:  120 EILVVEQGTLLVGFVTSNP-DNRLFSKVLNEGDVFVFPEGLIHFQANIGKAPAVAFAALSSQNPGVITIANTVFGANPAINPTILAKAFQLNPRVVMDLQTKF 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL110_ARATH (Germin-like protein subfamily 1 member 10 OS=Arabidopsis thaliana GN=At5g38930 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 7.652e-32
Identity = 69/103 (66.99%), Postives = 83/103 (80.58%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 319
            EI +V  GTL VGFVTS+  +N L  KVLN+GDVFVFP+GLIHFQ NIGK  A A++AL+SQ PG +TIA TVFGANP+INP+ L KAFQ+DP++V DLQ KF
Sbjct:  120 EILVVELGTLLVGFVTSNP-DNRLFTKVLNEGDVFVFPEGLIHFQANIGKAPAVAFAALSSQNPGVITIAPTVFGANPAINPNILAKAFQVDPRVVMDLQTKF 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL19_ARATH (Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.908e-31
Identity = 67/104 (64.42%), Postives = 80/104 (76.92%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKFI 322
            E+  V  GTL+VGFVTS+   N L +K L +GDVFVFPQGLIHFQ N+GK  A A++ L+SQ PG +TIADTVFG+NP I+P FL  AFQ+DPKIV DLQ KFI
Sbjct:  118 EVLYVAVGTLFVGFVTSNP-ENRLFSKTLYEGDVFVFPQGLIHFQVNVGKYPAVAFAGLSSQNPGVITIADTVFGSNPQIDPSFLASAFQVDPKIVMDLQTKFI 220          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL17_ARATH (Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 8.461e-31
Identity = 65/103 (63.11%), Postives = 80/103 (77.67%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 319
            EI +V+EGTL VGFVTS+Q NN L +KVL  GDVFVFP G+IHFQ N+G+TNA A++ L SQ PG +TIAD VFG+ PSI P+ L KAFQLD  +VK L+ +F
Sbjct:  119 EILVVVEGTLLVGFVTSNQDNNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNAVAFAGLGSQNPGTITIADAVFGSKPSIMPEILAKAFQLDVNVVKYLEARF 221          
BLAST of FC929414 vs. ExPASy Swiss-Prot
Match: GL116_ARATH (Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.105e-30
Identity = 65/103 (63.11%), Postives = 82/103 (79.61%), Query Frame = 2
Query:   11 EIFLVLEGTLYVGFVTSDQLNNTLIAKVLNKGDVFVFPQGLIHFQFNIGKTNAAAYSALNSQFPGEVTIADTVFGANPSINPDFLGKAFQLDPKIVKDLQNKF 319
            EI +++EGTLYVGFV+S+Q NN L AKVL+ GDVFVFP G+IHFQ NIGK  A A++ L+SQ  G +TIA+TVFG+NP I P+ L +AFQLD  +VK+LQ KF
Sbjct:  117 EILVLVEGTLYVGFVSSNQDNNRLFAKVLHPGDVFVFPIGMIHFQLNIGKIPAIAFAGLSSQNAGVITIANTVFGSNPPIYPELLARAFQLDANVVKELQAKF 219          
The following BLAST results are available for this feature:
BLAST of FC929414 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 76
Match NameE-valueIdentityDescription
GL117_ARATH1.821e-3366.67Germin-like protein subfamily 1 member 17 OS=Arabi... [more]
GL115_ARATH1.821e-3366.67Germin-like protein subfamily 1 member 15 OS=Arabi... [more]
GL114_ARATH1.821e-3366.67Germin-like protein subfamily 1 member 14 OS=Arabi... [more]
GL119_ARATH9.039e-3365.71Germin-like protein subfamily 1 member 19 OS=Arabi... [more]
GL113_ARATH9.039e-3366.67Germin-like protein subfamily 1 member 13 OS=Arabi... [more]
GL111_ARATH2.630e-3266.99Germin-like protein subfamily 1 member 11 OS=Arabi... [more]
GL110_ARATH7.652e-3266.99Germin-like protein subfamily 1 member 10 OS=Arabi... [more]
GL19_ARATH2.908e-3164.42Putative germin-like protein subfamily 1 member 9 ... [more]
GL17_ARATH8.461e-3163.11Germin-like protein subfamily 1 member 7 OS=Arabid... [more]
GL116_ARATH1.105e-3063.11Germin-like protein subfamily 1 member 16 OS=Arabi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BH02RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BH02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929414 ID=FC929414|Name=FC929414|organism=Citrus clementina|type=EST|length=512bp
GGCACGAGGCGAAATCTTCTTAGTCCTGGAAGGAACTCTTTATGTCGGTT
TTGTGACATCAGACCAACTGAATAACACACTCATCGCAAAAGTTCTAAAT
AAGGGAGATGTTTTTGTGTTTCCACAAGGTTTGATTCACTTCCAATTCAA
CATTGGAAAAACAAATGCAGCTGCCTATTCTGCTCTAAACAGCCAATTCC
CGGGTGAAGTTACCATAGCCGACACAGTCTTTGGAGCCAATCCTTCAATC
AATCCCGATTTTCTTGGCAAGGCATTCCAGTTGGACCCAAAGATAGTGAA
AGATCTTCAAAATAAGTTCATTAATGGCAATTAGGAGAAGGAATTAATGA
GCTTTAATATAAATGGCCTCTTCACTAGTGGCTGTATTACTTTATCTCCA
GATTATCATATCTTAATTAATGTAATAAAAGAGGTCTCTCATGAACCTCT
CTCCAGGCTGACTGTGGCCATGTAATAAACATAATTGTTATTGTTAAAAA
AAAAAAAAAAAA
back to top