FC929417

Overview
NameFC929417
Unique NameFC929417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length213
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9445 contig Ccv1_Contig9445:1527..1738. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.331e-17
Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADF+L+P+RFEP GLIQLHAMRYGTVPIVAS
Sbjct:  474 ADFMLVPSRFEPCGLIQLHAMRYGTVPIVAS 504          

HSP 2 Score: 49.2914 bits (116), Expect = 4.331e-17
Identity = 20/35 (57.14%), Postives = 29/35 (82.86%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAV 207
            +GGLVDTV++G+TGFQMG+  V+C+ +D   VAA+
Sbjct:  505 TGGLVDTVKEGYTGFQMGALHVECDKIDSADVAAI 539          
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 5.630e-17
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADF+L+P+RFEP GLIQLHAMRYGTVPI AS
Sbjct:  473 ADFMLVPSRFEPCGLIQLHAMRYGTVPICAS 503          

HSP 2 Score: 50.8322 bits (120), Expect = 5.630e-17
Identity = 21/37 (56.76%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAVST 213
            +GGLVDTV++G+TGF MG+F V+C+ VDP  V  + T
Sbjct:  504 TGGLVDTVKEGYTGFHMGAFNVECDVVDPADVLKIVT 540          
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 5.630e-17
Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADF+L+P+RFEP GLIQLHAMRYGT+PI AS
Sbjct:  474 ADFMLVPSRFEPCGLIQLHAMRYGTIPICAS 504          

HSP 2 Score: 51.2174 bits (121), Expect = 5.630e-17
Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAVST 213
            +GGLVDTV +GFTGF MG+F V+C  VDP  V  ++T
Sbjct:  505 TGGLVDTVTEGFTGFHMGAFNVECATVDPADVQKIAT 541          
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 2.089e-16
Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADFI++P+RFEP GLIQLHAMRYGTVPIVAS
Sbjct:  476 ADFIIVPSRFEPCGLIQLHAMRYGTVPIVAS 506          

HSP 2 Score: 46.595 bits (109), Expect = 2.089e-16
Identity = 21/36 (58.33%), Postives = 26/36 (72.22%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAVS 210
            +GGLVDTV+ G+TGF +G F V CE VDP  V A +
Sbjct:  507 TGGLVDTVKDGYTGFHIGRFNVKCEVVDPDDVIATA 542          
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 5.961e-16
Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAVST 213
            +GGLVDTV++G+TGF MG+F VDCE VDP  V  V T
Sbjct:  505 TGGLVDTVKEGYTGFHMGAFNVDCETVDPEDVLKVIT 541          

HSP 2 Score: 51.9878 bits (123), Expect = 5.961e-16
Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADF+LIP+RFEP GLIQLHAMRYGT  I AS
Sbjct:  474 ADFMLIPSRFEPCGLIQLHAMRYGTPCICAS 504          
BLAST of FC929417 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 3.943e-14
Identity = 24/37 (64.86%), Postives = 28/37 (75.68%), Query Frame = 1
Query:  103 SGGLVDTVEKGFTGFQMGSFIVDCEAVDPVHVAAVST 213
            +GGLVDTV +G TGF MGSF V+ E VDP  VAAV +
Sbjct:  462 TGGLVDTVREGVTGFHMGSFNVEFETVDPTDVAAVGS 498          

HSP 2 Score: 48.521 bits (114), Expect = 3.943e-14
Identity = 22/31 (70.97%), Postives = 25/31 (80.65%), Query Frame = 3
Query:    9 ADFILIPNRFEPWGLIQLHAMRYGTVPIVAS 101
            ADFI+IP+RFEP GLIQL  M YG VPI +S
Sbjct:  431 ADFIIIPSRFEPCGLIQLQGMSYGVVPICSS 461          
The following BLAST results are available for this feature:
BLAST of FC929417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
SSG1_MANES4.331e-1787.10Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SOLTU5.630e-1783.87Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ANTMA5.630e-1780.65Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ARATH2.089e-1687.10Probable granule-bound starch synthase 1, chloropl... [more]
SSG1_IPOBA5.961e-1664.86Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1B_HORVU3.943e-1464.86Granule-bound starch synthase 1b, chloroplastic/am... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BH05RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BH05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929417 ID=FC929417|Name=FC929417|organism=Citrus clementina|type=EST|length=213bp
GGCACAAGGCTGATTTTATTTTGATTCCTAACAGATTTGAACCTTGGGGT
CTCATTCAGTTACATGCCATGCGTTATGGAACCGTACCTATCGTGGCTTC
CATCTGGTGGTTTGGTTGACACTGTGGAAAAAGGCTTTACAGGATTCCAG
ATGGGAAGCTTCATTGTTGACTGTGAGGCTGTGGATCCAGTACATGTGGC
TGCAGTGTCCACA
back to top