FC929426

Overview
NameFC929426
Unique NameFC929426
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length550
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10775 contig Ccv1_Contig10775:292..841. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus GN=PCKR1 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.449e-45
Identity = 86/94 (91.49%), Postives = 90/94 (95.74%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYG+KFADENF+KKHTGPGILSMANAGP TNGSQFF+CTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRT K VV+ DCGQLS
Sbjct:   79 GTGGESIYGAKFADENFIKKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTAKKVVVEDCGQLS 172          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CYPH_ALLCE (Peptidyl-prolyl cis-trans isomerase OS=Allium cepa GN=CYP PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.570e-44
Identity = 82/94 (87.23%), Postives = 88/94 (93.62%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYG+KF DENF+KKHTGPG+LSMANAGPGTNGSQFF+CT KT WLDGKHVVFGQVVEGMDVV+AIEKVGS SG+T KPV IADCGQLS
Sbjct:   57 GTGGESIYGAKFKDENFIKKHTGPGVLSMANAGPGTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRAIEKVGSQSGQTKKPVKIADCGQLS 150          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CYPH_SOLLC (Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum GN=CYP PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 6.089e-44
Identity = 83/93 (89.25%), Postives = 88/93 (94.62%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 279
            GTGGESIYG+KF DENFVKKHTGPGILSMANAGPGTNGSQFF+CTAKTEWL+GKHVVFGQVVEGMDV+K  E VGSSSGR +KPVVIADCGQL
Sbjct:   79 GTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFFICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL 171          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CP18C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Arabidopsis thaliana GN=CYP18-3 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.155e-43
Identity = 81/94 (86.17%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYGSKF DENF +KHTGPGILSMANAG  TNGSQFF+CT KT+WLDGKHVVFGQVVEG+DVVKAIEKVGSSSG+  KPVV+ADCGQLS
Sbjct:   79 GTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS 172          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CP19A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana GN=CYP19-1 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.500e-42
Identity = 80/94 (85.11%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYGSKF DENF+KKHTGPGILSMANAG  TNGSQFF+CT KT WLDGKHVVFGQVVEG++VV+ IEKVGS SGRT+KPVVIADCGQ+S
Sbjct:   80 GTGGESIYGSKFKDENFIKKHTGPGILSMANAGANTNGSQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS 173          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CP19B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 4.364e-42
Identity = 78/94 (82.98%), Postives = 87/94 (92.55%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYG+KF DENF +KHTGPGILSMANAG  TNGSQFF+CT KT+WLDGKHVVFGQVVEG+DVVKAIEK+GSSSG+  KPVVIADCG++S
Sbjct:   80 GTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCGEIS 173          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CYPH_LUPLU (Peptidyl-prolyl cis-trans isomerase OS=Lupinus luteus PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 7.443e-42
Identity = 77/94 (81.91%), Postives = 88/94 (93.62%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTG ESIYG+KFADENF+K+HTGPGILSMANAG GTNGSQFF+CT KTEWLDGKHVVFG+V+EGM+VV+ IEKVGS SG+T++PV IADCGQLS
Sbjct:   79 GTGAESIYGAKFADENFIKRHTGPGILSMANAGAGTNGSQFFICTEKTEWLDGKHVVFGKVIEGMNVVRDIEKVGSGSGKTSRPVTIADCGQLS 172          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CP18D_ARATH (Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Arabidopsis thaliana GN=CYP18-4 PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.230e-41
Identity = 77/94 (81.91%), Postives = 85/94 (90.43%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGGESIYG+KF DENF+KKHTG GILSMAN+GP TNGSQFF+CT KT WLDGKHVVFGQVV+G+DVVKAIEKVGS SG+T+K V I DCGQLS
Sbjct:   79 GTGGESIYGAKFKDENFIKKHTGAGILSMANSGPNTNGSQFFICTDKTSWLDGKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS 172          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: CYPH_BRANA (Peptidyl-prolyl cis-trans isomerase OS=Brassica napus GN=CYP PE=2 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 3.127e-40
Identity = 78/93 (83.87%), Postives = 81/93 (87.10%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQL 279
            GTGGESIYG KF DENFVKKHTGPGILSM NAG  TNGSQFF+CT KT WLDGKHVVFGQVVEGMDVV+ IEKVGS SGRT+K VV  DCGQL
Sbjct:   79 GTGGESIYGMKFKDENFVKKHTGPGILSMRNAGSNTNGSQFFICTEKTSWLDGKHVVFGQVVEGMDVVRDIEKVGSDSGRTSKKVVTCDCGQL 171          
BLAST of FC929426 vs. ExPASy Swiss-Prot
Match: PPIF_HUMAN (Peptidyl-prolyl cis-trans isomerase, mitochondrial OS=Homo sapiens GN=PPIF PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.006e-38
Identity = 73/94 (77.66%), Postives = 80/94 (85.11%), Query Frame = 1
Query:    1 GTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFVCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTNKPVVIADCGQLS 282
            GTGG+SIYGS+F DENF  KH GPG+LSMANAGP TNGSQFF+CT KT+WLDGKHVVFG V EGMDVVK IE  GS SGRT+K +VI DCGQLS
Sbjct:  114 GTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 207          
The following BLAST results are available for this feature:
BLAST of FC929426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 199
Match NameE-valueIdentityDescription
CYPH_CATRO1.449e-4591.49Peptidyl-prolyl cis-trans isomerase OS=Catharanthu... [more]
CYPH_ALLCE3.570e-4487.23Peptidyl-prolyl cis-trans isomerase OS=Allium cepa... [more]
CYPH_SOLLC6.089e-4489.25Peptidyl-prolyl cis-trans isomerase OS=Solanum lyc... [more]
CP18C_ARATH5.155e-4386.17Peptidyl-prolyl cis-trans isomerase CYP18-3 OS=Ara... [more]
CP19A_ARATH1.500e-4285.11Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Ara... [more]
CP19B_ARATH4.364e-4282.98Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Ara... [more]
CYPH_LUPLU7.443e-4281.91Peptidyl-prolyl cis-trans isomerase OS=Lupinus lut... [more]
CP18D_ARATH8.230e-4181.91Peptidyl-prolyl cis-trans isomerase CYP18-4 OS=Ara... [more]
CYPH_BRANA3.127e-4083.87Peptidyl-prolyl cis-trans isomerase OS=Brassica na... [more]
PPIF_HUMAN1.006e-3877.66Peptidyl-prolyl cis-trans isomerase, mitochondrial... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CA03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CA03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929426 ID=FC929426|Name=FC929426|organism=Citrus clementina|type=EST|length=550bp
GGAACCGGAGGCGAATCAATCTACGGCTCAAAATTCGCCGATGAGAACTT
CGTGAAGAAGCACACCGGCCCCGGAATCCTCTCCATGGCGAATGCCGGAC
CCGGAACCAACGGATCTCAGTTCTTCGTCTGTACGGCCAAGACCGAGTGG
CTCGATGGGAAGCACGTTGTGTTCGGTCAAGTCGTCGAAGGAATGGACGT
CGTCAAGGCCATCGAGAAAGTGGGGTCCAGCTCCGGAAGGACCAACAAGC
CCGTCGTGATCGCTGATTGCGGTCAATTGTCTTAGATTTGATCATGATAA
TGATCGCCATCATCACGAGCCGTCTGATCGCGATCGTGATGGTGATTATG
TTATCTATTATTATGTGGCCGTGTCTGTAGGACTTTTAATCTTTATCTAA
TTTTCCTGCTATGTTACTTGTTCGGGTTGGATCGGGTCTCCGGTGGTGGT
TCTTGATGAACTGTTTTTTATGTCTTTCTATGAGCTGCCTTTTTAAATAA
GATAGGGCTTGTCTTGTTATATTACATAAAAAAAAAAAAAAAAAAAAAAA
back to top