FC929463

Overview
NameFC929463
Unique NameFC929463
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length850
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10223 contig Ccv1_Contig10223:1..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX1_PEA (L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 2.581e-111
Identity = 194/250 (77.60%), Postives = 211/250 (84.40%), Query Frame = 3
Query:   78 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAEA 827
            M K+YPTVS DY+KA+EK KRKLRGFIAEK CAPL+LR+AWHSAGT+D KTKTGGPFGT++  AE AH ANNGLDIAVRLLEP KEQFP +SYAD YQLAGVV VE+TGGP++PFHPGR+DK EPP EGRLPDA +G+DHLR VFG  MGLSD+DIVALSGGHT+G  HKERSGFEGPWT NPLIFDNSYFTELLTGEKDGLLQLPSDKALL D VFRPLVEK               HLKLSELGFAEA
Sbjct:    1 MGKSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKHQAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLTGEKDGLLQLPSDKALLTDSVFRPLVEKYAADEDVFFADYAEAHLKLSELGFAEA 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX1_ARATH (L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2)

HSP 1 Score: 401.364 bits (1030), Expect = 3.371e-111
Identity = 191/250 (76.40%), Postives = 214/250 (85.60%), Query Frame = 3
Query:   78 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAEA 827
            MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTMR  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTLGRCHK+RSGFEG WT NPLIFDNSYF ELL+GEK+GLLQL SDKALLDDPVFRPLVEK               H+KLSELGFA+A
Sbjct:    1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELGFADA 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX1_ORYSJ (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 5.381e-109
Identity = 188/250 (75.20%), Postives = 212/250 (84.80%), Query Frame = 3
Query:   78 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAEA 827
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAGVV VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWTRNPL FDNSYFTELL+G+K+GLLQLPSDKALL DP FRPLVEK               HLKLSELGFA+A
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFRPLVEKYAADEKAFFEDYKEAHLKLSELGFADA 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX2_ORYSJ (L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.566e-108
Identity = 188/248 (75.81%), Postives = 209/248 (84.27%), Query Frame = 3
Query:   81 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAE 824
            +K+YPTVS++Y  AV K KRKLRG IAEKNCAPLMLR+AWHSAGT+DV ++TGGPFGTM+   EQ+H+AN GLDIAVRLL+P K+Q P +SYAD YQLAGVV VEVTGGP++PFHPGR DK EPP EGRLPDA QG+DHLRQVF AQMGLSDKDIVALSGGHTLGRCHKERSGFEG WT NPLIFDNSYFTEL++GEK+GLLQLPSDKAL+ DP FRPLVEK               HLKLSELGFAE
Sbjct:    3 SKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHSAGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAGVVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVALSGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAFRPLVEKYAADEDAFFADYAEAHLKLSELGFAE 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX1_ORYSI (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 4.556e-108
Identity = 187/250 (74.80%), Postives = 211/250 (84.40%), Query Frame = 3
Query:   78 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAEA 827
            M KNYP VS +Y++AVEK ++KLR  IAEK+CAPLMLR+AWHSAGT+DV +KTGGPFGTM+  AE +H+AN GLDIAVR+LEP KE+ PTISYAD YQLAGVV VEV+GGP +PFHPGR+DK  PP EGRLPDA +G+DHLRQVFGAQMGLSD+DIVALSGGHTLGRCHKERSGFEGPWTRNPL FDNSYFTELL+G+K+GLLQLPSDKALL DP F PLVEK               HLKLSELGFA+A
Sbjct:    1 MAKNYPVVSAEYQEAVEKARQKLRALIAEKSCAPLMLRLAWHSAGTFDVSSKTGGPFGTMKTPAELSHAANAGLDIAVRMLEPIKEEIPTISYADFYQLAGVVAVEVSGGPAVPFHPGREDKPAPPPEGRLPDATKGSDHLRQVFGAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTRNPLQFDNSYFTELLSGDKEGLLQLPSDKALLSDPAFCPLVEKYAADEKAFFEDYKEAHLKLSELGFADA 250          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX2_ARATH (L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3)

HSP 1 Score: 380.178 bits (975), Expect = 8.041e-105
Identity = 183/247 (74.09%), Postives = 206/247 (83.40%), Query Frame = 3
Query:   84 KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGFAE 824
            K+YP V E+YKKAV++CKRKLRG IAEK+CAP++LR+AWHSAGT+DVKTKTGGPFGT+R   E AH ANNGLDIAVRLL+P KE FP +SYAD YQLAGVV VE+TGGP+IPFHPGR DK EPP EGRLP A +G DHLR VFG +MGL+DKDIVALSGGHTLGRCHKERSGFEG WT NPLIFDNSYF E+L+GEK+GLLQLP+DKALLDDP+F P VEK               HLKLSELGFA+
Sbjct:    4 KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFG-RMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFAD 249          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX3_ARATH (L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.783e-81
Identity = 153/242 (63.22%), Postives = 175/242 (72.31%), Query Frame = 3
Query:   93 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGF 818
            P V  +Y K + K +R+LR  IA KNCAP+MLR+AWH AGTYD ++KTGGP G++R   E  H AN+GL IA+ L E  K + P I+YADLYQLAGVV VEVTGGPDI F PGR D    P+EGRLPDAKQG  HLR VF  +MGLSDKDIVALSGGHTLGR H ERSGF+GPWT+ PL FDNSYF ELL GE +GLL+LP+DK LL+DP FR LVE                H KLSELGF
Sbjct:    4 PIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVF-YRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGF 244          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX3_ORYSJ (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.688e-78
Identity = 145/242 (59.92%), Postives = 176/242 (72.73%), Query Frame = 3
Query:   93 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGF 818
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAGVV VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+   ERSGF+G WT++PL FDNSYF ELL    +GLL+LP+DKAL++DP FR  VE                H KLSELGF
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQKHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKLSELGF 245          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX3_ORYSI (Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.688e-78
Identity = 145/242 (59.92%), Postives = 176/242 (72.73%), Query Frame = 3
Query:   93 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGF 818
            P V  +Y   VE+ +R LR  IA K+CAP+MLR+AWH AGTYD  TKTGGP G++R   E +H+AN G+ IA+ LLEP K++ P I+YADLYQLAGVV VEVTGGP I + PGR D ++ P+EGRLPDAK+G  HLR+VF  +MGLSDKDIVALSGGHTLG+   ERSGF+G WT++PL FDNSYF ELL    +GLL+LP+DKAL++DP FR  VE                H KLSELGF
Sbjct:    5 PVVDAEYMAEVERARRDLRALIASKSCAPIMLRLAWHDAGTYDKATKTGGPNGSIRFPQEYSHAANAGIKIAIDLLEPMKQRHPKITYADLYQLAGVVAVEVTGGPTIDYVPGRRDSSDSPEEGRLPDAKKGAAHLREVF-YRMGLSDKDIVALSGGHTLGKARPERSGFDGAWTKDPLKFDNSYFIELLKENSEGLLKLPTDKALVEDPTFRRYVELYAKDEDAFFRDYAESHKKLSELGF 245          
BLAST of FC929463 vs. ExPASy Swiss-Prot
Match: APX4_ORYSJ (Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.205e-78
Identity = 147/242 (60.74%), Postives = 173/242 (71.49%), Query Frame = 3
Query:   93 PTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKXXXXXXXXXXXXXXXHLKLSELGF 818
            P V  +Y + V++ +R LR  I+ K CAP+MLR+AWH AGTYDV TKTGG  G++R   E  H +N GL IA+ LLEP K + P I+YADLYQLAGVV VEVTGGP + F PGR D +  P+EGRLPDAK+G  HLR +F  +MGLSDKDIVALSGGHTLGR H ERSGFEG WT+ PL FDNSYF ELL GE +GLL+LP+DKALL+DP FR  V+                H KLSELGF
Sbjct:    4 PVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGTYDVNTKTGGANGSIRYEEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVAVEVTGGPTVEFIPGRRDSSVCPREGRLPDAKKGALHLRDIF-YRMGLSDKDIVALSGGHTLGRAHPERSGFEGAWTQEPLKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYVDLYARDEDTFFKDYAESHKKLSELGF 244          
The following BLAST results are available for this feature:
BLAST of FC929463 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 89
Match NameE-valueIdentityDescription
APX1_PEA2.581e-11177.60L-ascorbate peroxidase, cytosolic OS=Pisum sativum... [more]
APX1_ARATH3.371e-11176.40L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis... [more]
APX1_ORYSJ5.381e-10975.20L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX2_ORYSJ1.566e-10875.81L-ascorbate peroxidase 2, cytosolic OS=Oryza sativ... [more]
APX1_ORYSI4.556e-10874.80L-ascorbate peroxidase 1, cytosolic OS=Oryza sativ... [more]
APX2_ARATH8.041e-10574.09L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis... [more]
APX3_ARATH2.783e-8163.22L-ascorbate peroxidase 3, peroxisomal OS=Arabidops... [more]
APX3_ORYSJ1.688e-7859.92Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX3_ORYSI1.688e-7859.92Probable L-ascorbate peroxidase 3 OS=Oryza sativa ... [more]
APX4_ORYSJ2.205e-7860.74Probable L-ascorbate peroxidase 4 OS=Oryza sativa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CD08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CD08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929463 ID=FC929463; Name=FC929463; organism=Citrus clementina; type=EST; length=850bp
CTCGTGCCTTATTCGGCACGAGGCTCGTTTGTTAAGGATTTGCGTCTCTC
TTTCTCATTTCATTCAGCGTTGAAAAGATGACGAAGAATTACCCCACTGT
TAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAG
GCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGTGG
CACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGG
AACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCG
ATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATC
TCCTACGCTGACCTTTATCAGCTTGCTGGTGTTGTTGGCGTTGAGGTTAC
CGGTGGGCCCGATATCCCCTTCCACCCGGGAAGAGATGACAAGGCTGAGC
CACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTG
AGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGC
TCTCTCTGGTGGCCACACCCTGGGAAGGTGCCACAAGGAGAGGTCTGGAT
TTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTC
ACGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGA
CAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATG
CTGCGGATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTCAAG
CTCTCTGAGCTAGGATTTGCTGAAGCCTAATTTAACTGAGTAAATAAATG
back to top