FC929467

Overview
NameFC929467
Unique NameFC929467
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length824
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9287 contig Ccv1_Contig9287:11..834. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929467 vs. ExPASy Swiss-Prot
Match: KCO1_ARATH (Calcium-activated outward-rectifying potassium channel 1 OS=Arabidopsis thaliana GN=KCO1 PE=1 SV=2)

HSP 1 Score: 192.971 bits (489), Expect = 1.751e-48
Identity = 108/207 (52.17%), Postives = 143/207 (69.08%), Query Frame = 3
Query:  225 MASNGANQPLL-SGFVDSTSQTNNKDA----PKRRRLRRCRSAPQTDVAALD---INEKDSTHLSESLFGKPRPNFKRVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGLFLSKAADYLVDKQEILLVKALHRYQKVGPTDILKEIETNKVRYK----CIIMLVL 809
            M+S+ A  PLL +  +D+ +Q  N ++     ++RRLRR RSAP+ D    D   I+E         +F    PN +RV+++LA YL  G+L FY V  QI G KT+ ++D++YFCIVTMTTVGYGDLVPNS  S+LL+CAFVF+GM LVG  LS+AADYLV+KQE LLV+A H  Q  GPTDILKE+ TNK+RYK    C++++VL
Sbjct:    1 MSSDAARTPLLPTEKIDTMAQDFNLNSRTSSSRKRRLRRSRSAPRGDCMYNDDVKIDEPPPHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVVDALYFCIVTMTTVGYGDLVPNSSASRLLACAFVFSGMVLVGHLLSRAADYLVEKQEALLVRAFHLRQSFGPTDILKELHTNKLRYKCYATCLVLVVL 207          
BLAST of FC929467 vs. ExPASy Swiss-Prot
Match: KCO5_ARATH (Probable calcium-activated outward-rectifying potassium channel 5, chloroplastic OS=Arabidopsis thaliana GN=KCO5 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.353e-16
Identity = 56/201 (27.86%), Postives = 100/201 (49.75%), Query Frame = 3
Query:  270 DSTSQTNNKDAPKRRRLRRCRSAPQTDVAALDINEKDSTHLSESLFGKPRPNFKRVLVYLAAYLGGGSLSFYAVN-SQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGLFLSKAADYLVDKQEILLVKAL--------HRYQKVGPTDILKEIETNKVRYK-------CIIMLVLELGLI 824
            DS S   N+   + R L R R+AP   V   D+  K       S   K     ++ +  L  YL  G +S Y+ N     G++T+ ++D++YFCIVTM T+GYGD+ P +  +K+ +  FV  G G + + LS   +Y++D QE +++  +        H + +    D + + E  ++R +       C+++L + +G +
Sbjct:   68 DSDSDETNRFLSQTRPLHRSRTAPAM-VIIKDLRTKPPETKKPSPVSKSI--IRQAIFLLIVYLTLG-VSIYSFNRDHYSGIETHPVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLDILLSGVVNYVLDLQESMILTGIQTRQHHQHHHHHRFSAKDYIIDFEKGRMRIRMKVCLALCVVVLCIGVGAL 264          
BLAST of FC929467 vs. ExPASy Swiss-Prot
Match: KCO6_ARATH (Probable calcium-activated outward-rectifying potassium channel 6 OS=Arabidopsis thaliana GN=KCO6 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.015e-16
Identity = 54/168 (32.14%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  318 LRRCRSAPQTDVAA---LDINEKDSTHLSESLFGKPRPNFKRVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGLFLSKAADYLVDKQE-ILLVKALHRYQKVGPTDILKEIETNKVRYKCIIMLVL 809
            L R ++AP   V       I +KD T  S S+        ++    L  YL  G L ++         +T+ ++D +YFCIVTM T+GYGD+ PNSVV+KL S  FV  G G + + LS    Y++D QE  +L  A  R +       + +++  ++R +  + L L
Sbjct:  118 LHRSKTAPAMAVINDLHHPIRQKDPTETSRSVV-------RQAFALLVVYLSLGVLIYWLNRDHYVVNQTHPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGMVSYVLDLQESYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALAL 278          
BLAST of FC929467 vs. ExPASy Swiss-Prot
Match: KCO2_ARATH (Probable calcium-activated outward-rectifying potassium channel 2 OS=Arabidopsis thaliana GN=KCO2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 45/134 (33.58%), Postives = 74/134 (55.22%), Query Frame = 3
Query:  432 RVLVYLAAYLGGGSLSFYAVNSQIEGLKTNEILDSIYFCIVTMTTVGYGDLVPNSVVSKLLSCAFVFTGMGLVGLFLSKAADYLVDKQE-ILLVKALHRYQKVGPTDILKE--IETNKVRYKCIIMLVLELGLI 824
            + +  L  YL  G L ++         +T+ ++D++YFCIVTM T+GYGD+ P+SVV+KL S  FV  G G + + LS    Y++D QE  +L  A +    +   D ++   I+  K R +  + + L LG++
Sbjct:  148 QAVALLVVYLSLGVLIYWLNRDSYNVKQTHPVVDALYFCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTYVLDLQENYMLETARNESLNLNDRDKVRSYIIDVKKGRMRIRLKVGLALGVV 281          
The following BLAST results are available for this feature:
BLAST of FC929467 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
KCO1_ARATH1.751e-4852.17Calcium-activated outward-rectifying potassium cha... [more]
KCO5_ARATH1.353e-1627.86Probable calcium-activated outward-rectifying pota... [more]
KCO6_ARATH3.015e-1632.14Probable calcium-activated outward-rectifying pota... [more]
KCO2_ARATH2.161e-1433.58Probable calcium-activated outward-rectifying pota... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CE02RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CE02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929467 ID=FC929467|Name=FC929467|organism=Citrus clementina|type=EST|length=824bp
GGCACGAGGCAACACACTCACTTCATAAAGTTTCTTCCTTGATCTGGGGG
TGGTCTTGTGTCAGCTTGATAATGAACTCTAGAAGAATATAAACTGATTT
TCCACTGGCAATTATGTTTATAATGTAAAGTTAACTCCCCAGAAGTATTG
TATATCATCTGATATCCTTGACAGTGACTGTGTTCATAATTCTAAAGGTC
TGAGTCCGCTTTTGCTATCCTCTAATGGCCTCCAATGGTGCAAATCAGCC
GCTGCTCTCAGGATTTGTTGATTCAACGTCTCAAACAAATAATAAAGATG
CTCCCAAGAGAAGAAGGCTTCGTCGGTGTAGAAGTGCTCCCCAGACTGAT
GTTGCTGCTCTAGACATAAATGAAAAAGACTCAACTCACCTTTCTGAGTC
CCTTTTTGGCAAACCCCGCCCAAATTTTAAGAGGGTACTTGTCTACCTGG
CTGCCTACCTTGGTGGGGGGTCATTATCCTTCTATGCTGTCAACAGTCAA
ATCGAAGGACTAAAAACCAATGAAATTCTAGATTCTATTTATTTCTGCAT
CGTGACAATGACCACTGTAGGGTATGGAGACCTTGTGCCTAATAGTGTCG
TTTCGAAACTACTTTCCTGTGCTTTTGTTTTCACAGGGATGGGTCTAGTT
GGTCTGTTTCTGAGCAAAGCAGCCGACTATCTGGTCGACAAGCAGGAAAT
ATTGCTGGTTAAAGCCCTACACAGGTATCAAAAAGTTGGCCCGACTGATA
TTCTAAAGGAGATTGAAACCAACAAAGTGAGATACAAATGCATCATCATG
TTGGTCCTTGAGTTGGGTCTCATT
back to top