FC929478

Overview
NameFC929478
Unique NameFC929478
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length805
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929478_ssr234 microsatellite FC929478_ssr234:234..245. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15047 contig Ccv1_Contig15047:1..805. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.708e-117
Identity = 207/238 (86.97%), Postives = 219/238 (92.02%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I VSKLRGKR              NWLQVGDDLNHRNL+DLAKK+GD+ LLRMGQRNLVVVSSPD +KEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R+ WE+EAA+VVEDVKK+PEAATNGIVLRRRLQLMMYNNMYRIMFDRRFES+DDPLFN+LKALNGERSRLAQSF+YNYGDFIPILRPFLRGYLKIC+EVKERRLQLFKDYFV
Sbjct:   21 ILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPDLSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEEEAAQVVEDVKKNPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFNKLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICQEVKERRLQLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.224e-115
Identity = 204/238 (85.71%), Postives = 219/238 (92.02%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I VSKLRGKR              NWLQVGDDLNHRNL+DLAKK+GD+LLLRMGQRNLVVVSSP+ +KEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R+ WE+EAA+VVEDVKK+P AAT+GIVLRRRLQLMMYNNMYRIMFDRRFES++DPLFN+LKALNGERSRLAQSF+YNYGDFIPILRPFLRGYLKIC+EVKERRLQLFKDYFV
Sbjct:   21 ILVSKLRGKRFKLPPGPLPVPVFGNWLQVGDDLNHRNLTDLAKKFGDILLLRMGQRNLVVVSSPELSKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEEEAAQVVEDVKKNPGAATHGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFNKLKALNGERSRLAQSFDYNYGDFIPILRPFLRGYLKICQEVKERRLQLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_CATRO (Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 4.651e-115
Identity = 203/236 (86.02%), Postives = 215/236 (91.10%), Query Frame = 2
Query:   98 VSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            VSKLRGK+              NWLQVGDDLNHRNLSD AKK+G++ LLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R+ WE+EAARVVEDVKK+PE+ATNGIVLRRRLQLMMYNNMYRIMFDRRFES+DDPLF +LKALNGERSRLAQ FEYNYGDFIPILRPFLRGYL+ICKEVKERRLQLFKDYFV
Sbjct:   23 VSKLRGKKFKLPPGPIPVPVFGNWLQVGDDLNHRNLSDYAKKFGEIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEEEAARVVEDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEDDPLFVKLKALNGERSRLAQGFEYNYGDFIPILRPFLRGYLRICKEVKERRLQLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_RUTGR (Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.036e-114
Identity = 205/238 (86.13%), Postives = 215/238 (90.34%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I VSKLRGKR              NWLQVGDDLN R L++L+KK+GDV LLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVY EHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDP+AAT GIVLRRRLQL+MYNNMYRIMFDRRFES DDPLFN+LKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLK+ KEVKERRL+LFKDYFV
Sbjct:   21 IAVSKLRGKRFKLPPGPLGFPVFGNWLQVGDDLNQRKLANLSKKFGDVYLLRMGQRNLVVVSSPEMAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPQAATTGIVLRRRLQLLMYNNMYRIMFDRRFESVDDPLFNKLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKLVKEVKERRLKLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 2.161e-112
Identity = 197/238 (82.77%), Postives = 214/238 (89.92%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I +SKLRG+R              NWLQVGDDLNHRNL+DLAK++GD+ LLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ RF WE EAA VV+DV+++P+AA  GIVLRRRLQLMMYNNMYRIMFDRRFES++DPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKERRL+LFKDYFV
Sbjct:   21 IAISKLRGRRFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRFGWESEAASVVDDVRRNPDAAAGGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKERRLKLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 2.389e-111
Identity = 195/238 (81.93%), Postives = 214/238 (89.92%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I +SKLRGK+              NWLQVGDDLNHRNL+DLAK++G++LLLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R+ WE EAA VV+DVKK+P AAT GIV+RRRLQLMMYNNM+RIMFDRRFES+DDPLF +LKALNGERSRLAQSFEYNYGDFIPILRPFLR YLK+CKEVK++R+QLFKDYFV
Sbjct:   21 ILISKLRGKKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDLAKRFGEILLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPAAATEGIVIRRRLQLMMYNNMFRIMFDRRFESEDDPLFLKLKALNGERSRLAQSFEYNYGDFIPILRPFLRNYLKLCKEVKDKRIQLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_PHAAU (Trans-cinnamate 4-monooxygenase OS=Phaseolus aureus GN=CYP73A2 PE=1 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 4.075e-111
Identity = 196/238 (82.35%), Postives = 212/238 (89.08%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I VSKLRGKR              NWLQVGDDLNHRNL+ LAK++GD+ LLRMGQRNLVVVSSPD AKEVLHTQGVEFGSRTRNVVFDIFTG+GQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R  WE EAA VV+DV+K+P+AA +G+V+RRRLQLMMYNNMYRIMFDRRFES++DPLF RLKALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKE RL+LFKDYFV
Sbjct:   21 IVVSKLRGKRFKLPPGPLPVPIFGNWLQVGDDLNHRNLTQLAKRFGDIFLLRMGQRNLVVVSSPDLAKEVLHTQGVEFGSRTRNVVFDIFTGEGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRHGWEAEAAAVVDDVRKNPDAAVSGLVIRRRLQLMMYNNMYRIMFDRRFESEEDPLFQRLKALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKETRLKLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_SOYBN (Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 9.077e-111
Identity = 195/238 (81.93%), Postives = 211/238 (88.66%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I VS LRG++              NWLQVGDDLNHRNL+DLAKK+GD+ LLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R  WE EAA VVEDVKK+P+AA +G V+RRRLQLMMYNNMYRIMFDRRFES++DP+F RL+ALNGERSRLAQSFEYNYGDFIPILRPFL+GYLKICKEVKE RL+LFKDYFV
Sbjct:   21 IAVSTLRGRKFKLPPGPLPVPIFGNWLQVGDDLNHRNLTDLAKKFGDIFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRHGWESEAAAVVEDVKKNPDAAVSGTVIRRRLQLMMYNNMYRIMFDRRFESEEDPIFQRLRALNGERSRLAQSFEYNYGDFIPILRPFLKGYLKICKEVKETRLKLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_ZINEL (Trans-cinnamate 4-monooxygenase OS=Zinnia elegans GN=CYP73A12 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.022e-110
Identity = 194/238 (81.51%), Postives = 212/238 (89.08%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            I +SKLRGKR              NWLQVGDDLNHRNL+DLAKK+G++ LLRMGQRNLVVVSSP+ AKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQ R  WE EAA VV+DVKK+P+AAT G+V+R+RLQLMMYNNM+RIMFDRRFES+DDPLF +LK LNGERSRLAQSFEYNYGDFIPILRPFL+GYLK+CKEVKE+R QLFKDYFV
Sbjct:   21 IFISKLRGKRFKLPPGPVPVPIFGNWLQVGDDLNHRNLTDLAKKFGEIFLLRMGQRNLVVVSSPNLAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRTGWEAEAAAVVDDVKKNPKAATEGVVIRKRLQLMMYNNMFRIMFDRRFESEDDPLFVKLKMLNGERSRLAQSFEYNYGDFIPILRPFLKGYLKLCKEVKEKRFQLFKDYFV 258          
BLAST of FC929478 vs. ExPASy Swiss-Prot
Match: TCMO_PETCR (Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 3.449e-110
Identity = 194/238 (81.51%), Postives = 212/238 (89.08%), Query Frame = 2
Query:   92 ITVSKLRGKRXXXXXXXXXXXXXXNWLQVGDDLNHRNLSDLAKKYGDVLLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQQRFNWEDEAARVVEDVKKDPEAATNGIVLRRRLQLMMYNNMYRIMFDRRFESQDDPLFNRLKALNGERSRLAQSFEYNYGDFIPILRPFLRGYLKICKEVKERRLQLFKDYFV 805
            IT+SKLRGK+              NWLQVGDDLN RNL D AKK+GD+ +LRMGQRNLVVVSSP+ AK+VLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVY EHWRKMRRIMTVPFFTNKVVQQ RF WEDEAARVVEDVK +PEAATNGIVLR RLQL+MYNNMYRIMFDRRFES DDPLF +LKALNGERSRLAQSFEY++GDFIPILRPFLRGYLK+C+E+K++RL+LFKDYFV
Sbjct:   22 ITISKLRGKKLKLPPGPIPVPVFGNWLQVGDDLNQRNLVDYAKKFGDLFMLRMGQRNLVVVSSPELAKDVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYSEHWRKMRRIMTVPFFTNKVVQQYRFGWEDEAARVVEDVKANPEAATNGIVLRNRLQLLMYNNMYRIMFDRRFESVDDPLFLKLKALNGERSRLAQSFEYHFGDFIPILRPFLRGYLKLCQEIKDKRLKLFKDYFV 259          
The following BLAST results are available for this feature:
BLAST of FC929478 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
TCMO_POPKI1.708e-11786.97Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
TCMO_POPTM1.224e-11585.71Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_CATRO4.651e-11586.02Trans-cinnamate 4-monooxygenase OS=Catharanthus ro... [more]
TCMO_RUTGR1.036e-11486.13Trans-cinnamate 4-monooxygenase OS=Ruta graveolens... [more]
TCMO_GLYEC2.161e-11282.77Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
TCMO_HELTU2.389e-11181.93Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
TCMO_PHAAU4.075e-11182.35Trans-cinnamate 4-monooxygenase OS=Phaseolus aureu... [more]
TCMO_SOYBN9.077e-11181.93Trans-cinnamate 4-monooxygenase OS=Glycine max GN=... [more]
TCMO_ZINEL2.022e-11081.51Trans-cinnamate 4-monooxygenase OS=Zinnia elegans ... [more]
TCMO_PETCR3.449e-11081.51Trans-cinnamate 4-monooxygenase OS=Petroselinum cr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CF02RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CF02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929478 ID=FC929478|Name=FC929478|organism=Citrus clementina|type=EST|length=805bp
GGCACGAGGATTCATTACGTTAATCGTAAAGATGGATCTCCTCTTGCTGG
AAAAGACGCTTTTAGCCCTCTTCGCCGCCGTTGTTGTCGCCATTACCGTC
TCTAAACTCCGCGGAAAGCGCTTCAAGCTCCCCCCCGGCCCCCTCCCCGT
CCCCGTATTCGGCAACTGGCTCCAGGTCGGCGATGACTTGAACCATCGGA
ACCTCTCCGACTTAGCCAAGAAATATGGAGATGTCCTCCTCCTCCGCATG
GGCCAGCGCAACCTCGTCGTCGTCTCGTCGCCGGACCACGCCAAGGAGGT
TCTGCACACGCAGGGAGTGGAGTTCGGATCACGAACGAGGAACGTCGTGT
TCGATATCTTCACTGGGAAGGGCCAGGACATGGTGTTCACAGTGTACGGC
GAGCACTGGCGGAAGATGCGGAGGATCATGACCGTCCCTTTCTTCACGAA
CAAAGTGGTTCAGCAGCAGCGGTTTAATTGGGAAGACGAGGCCGCTAGAG
TCGTTGAGGATGTTAAGAAGGACCCCGAGGCGGCGACCAATGGGATCGTC
TTGAGGAGGCGGCTGCAGCTTATGATGTACAACAACATGTACAGGATTAT
GTTTGATAGAAGATTCGAGAGTCAGGATGATCCTTTGTTTAACAGATTAA
AGGCTTTGAATGGTGAGAGGAGTCGGTTGGCCCAGAGCTTTGAGTACAAT
TACGGTGATTTTATTCCCATTTTGAGACCTTTCTTGAGAGGCTACTTGAA
GATTTGTAAGGAAGTTAAAGAAAGGAGACTCCAGCTCTTCAAGGACTACT
TTGTT
back to top