FC929484

Overview
NameFC929484
Unique NameFC929484
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length737
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15049 contig Ccv1_Contig15049:1..737. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929484 vs. ExPASy Swiss-Prot
Match: Y2309_ARATH (Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 3.831e-33
Identity = 65/78 (83.33%), Postives = 71/78 (91.03%), Query Frame = 2
Query:  341 MGGGNGQKSKMAREKNMEKQKAAGKGSQLESNKKAMSIQCKGCMQTFICTTSEVKCKEHAEARHPKSDLFTCFPHLKK 574
            MGGGN QKS MAR KN+EK KAAGKGSQLE+NKKAMSIQCK CMQTFICTTSEVKC+EHAEA+HPK+D+  CFPHLKK
Sbjct:    1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLKK 78          
The following BLAST results are available for this feature:
BLAST of FC929484 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y2309_ARATH3.831e-3383.33Uncharacterized protein At2g23090 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CF08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CF08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929484 ID=FC929484|Name=FC929484|organism=Citrus clementina|type=EST|length=737bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAAAAAACTCAGTCTCCATT
ACGTGAATATATCCCAATACTACAAATAACATTCAACACCTGGGTATTTA
CGTGAAATTACAGGGAACCCTTCCCTTAAAACCCCCCATGAACTTTCTAC
GTAGTATCAAAAACTAAATACATCATAAAATGAACACAGAAACATAAAAA
CCACATTTTAAACCCACAGATCCAAGTGAACAAAACAAAACTAATCACCG
GAGTCGCCTCGTGCCGAATTCGGCACGAGGTTTGGGTATTTTTATTCGTA
ACTTAACGATTCCTGTTAGCTTCTGTGGTTTGTAAAGGAAATGGGAGGCG
GCAACGGCCAAAAATCAAAGATGGCTCGTGAGAAAAACATGGAAAAGCAA
AAAGCAGCTGGCAAGGGGAGTCAGCTGGAGTCAAACAAGAAAGCCATGTC
CATCCAGTGCAAGGGATGCATGCAGACGTTCATTTGCACCACATCTGAGG
TGAAGTGCAAGGAACATGCCGAAGCCAGACACCCCAAATCTGATTTATTT
ACATGTTTCCCCCATTTAAAGAAATGAAAAACCAATAATTTGATTATGTA
TTTGGAGATGGGTTTAAAGCCCTCGTCAGTATGTGTCTTGCTGTGGGTTA
AAATTAGAAAGATTTTGGGAAAAAGAGGGATCCTTCCAGTCTTATCAATA
CTAATAATTAACTATTTGCAAAAAAAAAAAAAAAAAA
back to top