FC929498

Overview
NameFC929498
Unique NameFC929498
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length873
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929498_ssr138 microsatellite FC929498_ssr138:138..149. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9264 contig Ccv1_Contig9264:11..882. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929498 vs. ExPASy Swiss-Prot
Match: FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.211e-20
Identity = 45/75 (60.00%), Postives = 60/75 (80.00%), Query Frame = 1
Query:  490 KIGARVKVKVPLKVYHVPRVPELDLSGMEGVLKQYVGVWKGKKISANLPYKVAFVTEIEG--RTVKFFAHLKDDE 708
            KIG RV+V  PL+VYHV + P+LD+ GMEGV+KQYV VWKGK+++AN P+KV F   +EG  + V+FFAHL++DE
Sbjct:   17 KIGRRVRVTAPLRVYHVLKAPDLDIQGMEGVVKQYVCVWKGKRVTANFPFKVEFELAVEGQPKPVRFFAHLREDE 91          
BLAST of FC929498 vs. ExPASy Swiss-Prot
Match: FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea GN=FTRV PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.070e-18
Identity = 51/111 (45.95%), Postives = 70/111 (63.06%), Query Frame = 1
Query:  382 ISCEVAVKSNNSTASVGLEXXXXXXXXXXDDGFDESKIGARVKVKVPLKVYHVPRVPELDLS-GMEGVLKQYVGVWKGKKISANLPYKVAFVTEIEGR-TVKFFAHLKDDE 708
            I CEVA+KS++ST                    +  K+G +VKVK PLKVYHVP++PE++L+  M GV+KQYVG WKGK IS N P+KV +  ++  R +VK   HLK++E
Sbjct:   60 ICCEVALKSDSSTGFDSSSSSPPEEDEELKKNLE--KVGCKVKVKSPLKVYHVPKLPEVELTPDMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVPDRGSVKLVVHLKEEE 168          
The following BLAST results are available for this feature:
BLAST of FC929498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
FTRV_MAIZE2.211e-2060.00Ferredoxin-thioredoxin reductase, variable chain O... [more]
FTRV_SPIOL2.070e-1845.95Ferredoxin-thioredoxin reductase, variable chain, ... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CH01RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CH01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929498 ID=FC929498|Name=FC929498|organism=Citrus clementina|type=EST|length=873bp
GGCACGAGGAGGAGAGGATGTATACGATCTAGAGTGTTATTCATTCGACA
CGTGTGCAATAGAGACGAAAGTCCGTTGCCATCGTCTTAGCTCGCCTTAG
CCACTGAGGCCTGAGATAGTGGTTCAATAGAAAAATCAATAATAATAATA
AAAAAAAGAGTAAAGGTTGGGTAATATCATTATTATTATATGATTATTTT
GTGAGAATTAGCAGACGAGTGAAAAGATAGATACACAGAAATCATGACTA
GTACAAGTTTTGCTTTGTCCTCGGCTACTTCTTCGTTGATAAATCGACGG
CCACTTGCGAATGCGTTTGTCTCAGTTTCTTCATTTTCAGCTGCCAATTG
TAATTACAATGTTAATGTTAACAAAAGAAGAATCTCCTGTGAAGTAGCTG
TAAAATCCAACAATTCAACGGCATCCGTAGGACTAGAGAGCAGTCCATCT
TCATCAGCATCAGCGTCGGATGATGGCTTTGATGAGTCTAAGATTGGTGC
GAGGGTTAAGGTGAAGGTGCCGTTGAAGGTTTACCATGTTCCTAGGGTTC
CGGAGCTTGATCTGTCTGGCATGGAAGGTGTGCTCAAGCAATACGTCGGC
GTTTGGAAAGGAAAGAAAATCTCAGCCAATCTGCCTTATAAGGTAGCGTT
TGTTACTGAAATTGAAGGCCGTACTGTCAAGTTCTTTGCACATCTCAAGG
ATGATGAGTTTGATTACCTTGATTAATATTTTTAAATTTTTATTATTTTG
AACATGTTATTCCTTCTCTTTCCTATCTCTATCCTCTACAAATAATATTT
TTAGTCTTTGTATGTAACTCTTCACATGAGATTATGCTTCTTAGTGTTTT
TATTGTTATACTTTTCTCTTGCT
back to top