FC929502

Overview
NameFC929502
Unique NameFC929502
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length860
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11159 contig Ccv1_Contig11159:564..1423. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929502 vs. ExPASy Swiss-Prot
Match: ESCA_ARATH (Putative DNA-binding protein ESCAROLA OS=Arabidopsis thaliana GN=ESC PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.262e-12
Identity = 48/122 (39.34%), Postives = 66/122 (54.10%), Query Frame = 1
Query:  457 RPKRSPASDSQAL-KRSRGRPPGTGRKQQLATLGEWMNSSAGIAFAPHVISIGVGEDIVAKMLSFSQQRPRVVCILSGRGTVSSVTLRQPAT---------SVPTVTYDGRFEILCLSGSFL 792
            RP   P + S A  KR RGRPPG+  K +   +   +   +  A   HV+ +  G DIV  + +++++R R V +L G GTVS+VTLRQP T             VT  GRFEIL L+G+ L
Sbjct:   72 RPDSDPNTSSSAPGKRPRGRPPGSKNKAKPPII---VTRDSPNALRSHVLEVSPGADIVESVSTYARRRGRGVSVLGGNGTVSNVTLRQPVTPGNGGGVSGGGGVVTLHGRFEILSLTGTVL 190          
The following BLAST results are available for this feature:
BLAST of FC929502 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ESCA_ARATH1.262e-1239.34Putative DNA-binding protein ESCAROLA OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2CH05RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2CH05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929502 ID=FC929502|Name=FC929502|organism=Citrus clementina|type=EST|length=860bp
GTGTTAGGGAGATCAGGATCTTGTGTGTATTTAGTTTAAGATTTTAGCTT
AAGTGGCTTAATAGACTCATTTTCTAGCTACCCAAAAAGAAAAAAAATTC
ATTTTCTACTTAGTAAATGCATGGACGGAAGAGAAGCTATGGTTGCATCA
GGGGGTGTCTCTGGTCCCTATTACATTCAACAACATAGAGGAGCATTCAG
TGGTTCTCATTCAGCAACACAATCTGGTTTAATGCAAACCCCACCTGGGT
TTAGATCCTCGTCAAATCTTAACATTCCAACTCAACCAAATGTGGGATCG
ACATTTGCAGTTGAGCCCAAACATGTCAATTTTGGCCATAACATGAGTGT
GCCATCCGGGGTGCCACTAAGTGATCCAGTGAAGAAGAAGAGAGGTAGAC
CCCGCAAATATGCCCCTGATGGGCAGGTTTCCTTGGGGCTTTCGCCATTG
CCAGCCAGGCCAAAGCGTTCTCCGGCATCTGATTCGCAGGCCTTGAAACG
GAGTAGAGGGCGGCCTCCTGGGACAGGCAGGAAGCAGCAGTTGGCTACTC
TTGGTGAATGGATGAATAGTTCAGCTGGAATTGCTTTTGCACCGCATGTG
ATCTCCATTGGAGTTGGAGAGGACATTGTGGCTAAAATGTTGTCATTTTC
ACAACAGAGGCCAAGGGTTGTGTGCATCTTGTCAGGCCGTGGTACAGTTT
CTTCAGTAACACTCCGTCAGCCTGCAACTTCAGTGCCCACCGTCACCTAT
GATGGCCGTTTCGAGATATTATGCCTGTCTGGTTCATTCTTACTTGCTGA
AGATGGCAGTCCTCGTGATCGAACTGGTGGTGTAAGTGCTTCCCTTTCAA
GTCCTGATGG
back to top