FC929525

Overview
NameFC929525
Unique NameFC929525
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length652
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9255 contig Ccv1_Contig9255:2..653. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG7_MANES (Anthocyanidin 3-O-glucosyltransferase 7 (Fragment) OS=Manihot esculenta GN=GT7 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.163e-67
Identity = 101/162 (62.35%), Postives = 128/162 (79.01%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIV 486
            GM+KI++ DLPEGV+ G+L+S+FS MLH MGR LP+AAAV +NSFEELDP + + L +KFNN  L +GPF L+       S    + D YGC+AWLDKQK  PASVAY+SFG+VATP P+E+VA+AEALEASKVPF+WSL+  S+ +LPNGFL+RT+S GIV
Sbjct:    7 GMSKIQIRDLPEGVLFGNLESLFSQMLHNMGRMLPRAAAVLMNSFEELDPTIVSDLNSKFNN-ILCIGPFNLV-------SPPPPVPDTYGCMAWLDKQK--PASVAYISFGSVATPPPHELVALAEALEASKVPFLWSLKDHSKVHLPNGFLDRTKSHGIV 158          

HSP 2 Score: 66.6254 bits (161), Expect = 3.163e-67
Identity = 30/40 (75.00%), Postives = 32/40 (80.00%), Query Frame = 3
Query:  531 LGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            LG    HCGW SILESI  GVPMI RPFFGDQR+NGRM+E
Sbjct:  173 LGVFVTHCGWNSILESIVGGVPMICRPFFGDQRLNGRMVE 212          

HSP 3 Score: 30.8018 bits (68), Expect = 3.163e-67
Identity = 12/22 (54.55%), Postives = 16/22 (72.73%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            + + WA QV +L H A+GVFVT
Sbjct:  157 IVLSWAPQVEILEHAALGVFVT 178          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UGFGT_ARATH (Flavonoid 3-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT78D2 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 2.479e-63
Identity = 97/162 (59.88%), Postives = 122/162 (75.31%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIV 486
            GM KIRV D PEGVV G+LDSVFS MLHQMG  LP+A AVFINSFE+LDP LTN+L+++F  ++L++GP  LL ++ QQ      + D +GCLAW+  +K+   SVAY+SFGTV TP P E+ AIAE LE+SKVPF+WSL+ +S   LP GFL+RTR  GIV
Sbjct:  182 GMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATAVFINSFEDLDPTLTNNLRSRF-KRYLNIGPLGLLSSTLQQL-----VQDPHGCLAWM--EKRSSGSVAYISFGTVMTPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIV 335          

HSP 2 Score: 62.7734 bits (151), Expect = 2.479e-63
Identity = 25/34 (73.53%), Postives = 30/34 (88.24%), Query Frame = 3
Query:  549 HCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            HCGW S+LES++ GVPMI RPFFGDQR+NGR +E
Sbjct:  356 HCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVE 389          

HSP 3 Score: 32.7278 bits (73), Expect = 2.479e-63
Identity = 14/22 (63.64%), Postives = 16/22 (72.73%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            + V WA QV +L HEA GVFVT
Sbjct:  334 IVVPWAPQVELLKHEATGVFVT 355          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG_VITVI (Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis vinifera GN=UFGT PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.070e-60
Identity = 91/162 (56.17%), Postives = 120/162 (74.07%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIV 486
            GM+K+R  DL EG+V G+L+S+FS MLH+MG+ LPKA AVFINSFEELD  LTN LK+K    +L++GPF L+      P++        GCL WL  +++KP SV Y+SFGTV TP P E+VA++EALEAS+VPFIWSLR +++ +LP GFLE+TR  G+V
Sbjct:  178 GMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKT-YLNIGPFNLITPPPVVPNTT-------GCLQWL--KERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMV 329          

HSP 2 Score: 63.5438 bits (153), Expect = 1.070e-60
Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query:  531 LGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            +G+   HCGW S+ ES+A GVP+I RPFFGDQR+NGRM+E
Sbjct:  344 VGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVE 383          

HSP 3 Score: 34.2686 bits (77), Expect = 1.070e-60
Identity = 15/22 (68.18%), Postives = 16/22 (72.73%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            + V WA Q  VLAHEAVG FVT
Sbjct:  328 MVVPWAPQAEVLAHEAVGAFVT 349          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: KGLT_PETHY (Kaempferol 3-O-beta-D-galactosyltransferase OS=Petunia hybrida PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.719e-58
Identity = 92/160 (57.50%), Postives = 116/160 (72.50%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            G  ++R+  LP GVVSGDL+S FSVMLH+MG+ + KA A+ +NSFEELDP +   LK+KFNN FL+VGPF L       P  + ++ DEYGC+AWLDKQ  +P SVAY+ FGTVATP PNE+ A+AEALE SK PF+WSL+   ++  P GFLERT   G
Sbjct:  172 GFAELRLGSLPSGVVSGDLESPFSVMLHKMGKTIGKATALPVNSFEELDPPIVEDLKSKFNN-FLNVGPFNL-----TTPPPSANITDEYGCIAWLDKQ--EPGSVAYIGFGTVATPPPNELKAMAEALEESKTPFLWSLKDLFKSFFPEGFLERTSEYG 323          

HSP 2 Score: 57.7658 bits (138), Expect = 2.719e-58
Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 3
Query:  549 HCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            HCGW S+LESIAAGVP+I RPFFGD ++N  M+E
Sbjct:  346 HCGWNSVLESIAAGVPVICRPFFGDHQLNAWMVE 379          

HSP 3 Score: 30.0314 bits (66), Expect = 2.719e-58
Identity = 12/19 (63.16%), Postives = 15/19 (78.95%), Query Frame = 2
Query:  488 VDWATQVNVLAHEAVGVFV 544
            V WA QV VL+H +VGVF+
Sbjct:  326 VSWAPQVQVLSHGSVGVFI 344          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: FORT_ARATH (Flavonol-3-O-glucoside L-rhamnosyltransferase OS=Arabidopsis thaliana GN=UGT78D1 PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.839e-53
Identity = 83/162 (51.23%), Postives = 114/162 (70.37%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIV 486
            GM   RV D+PE VV  DLDSVF   L+QM   LP+A+AVFI+SFEEL+P L  +L++K   +FL++ P  LL ++ ++     ++ D +GC AW+ K  +  ASVAY+SFGTV  P P E+VAIA+ LE+SKVPF+WSL+ ++  +LP GFL+RTR  GIV
Sbjct:  176 GMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEPTLNYNLRSKLK-RFLNIAPLTLLSSTSEK-----EMRDPHGCFAWMGK--RSAASVAYISFGTVMEPPPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGFLDRTREQGIV 329          

HSP 2 Score: 58.9214 bits (141), Expect = 3.839e-53
Identity = 23/34 (67.65%), Postives = 28/34 (82.35%), Query Frame = 3
Query:  549 HCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            HCGW S+LES++AGVPMIGRP   D R+NGR +E
Sbjct:  350 HCGWNSVLESVSAGVPMIGRPILADNRLNGRAVE 383          

HSP 3 Score: 29.6462 bits (65), Expect = 3.839e-53
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            + V WA QV +L HEA+GV VT
Sbjct:  328 IVVPWAPQVELLKHEAMGVNVT 349          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG_GENTR (Anthocyanidin 3-O-glucosyltransferase OS=Gentiana triflora PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 3.592e-46
Identity = 72/160 (45.00%), Postives = 104/160 (65.00%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            G++ I  +DLPE ++  D  S+F++ LH MG +L KA AV +NSFEE+DP +TNHL++      L++GP + L       SS    D+E  CL WL  QK+  +SV Y+SFGTV  P PNE+ A+A  LE+ K+PF+WSLR  ++ +LP  F++RT + G
Sbjct:  176 GLSAISFSDLPEELIMEDSQSIFALTLHNMGLKLHKATAVAVNSFEEIDPIITNHLRSTNQLNILNIGPLQTL------SSSIPPEDNE--CLKWLQTQKE--SSVVYLSFGTVINPPPNEMAALASTLESRKIPFLWSLRDEARKHLPENFIDRTSTFG 325          

HSP 2 Score: 58.9214 bits (141), Expect = 3.592e-46
Identity = 25/40 (62.50%), Postives = 30/40 (75.00%), Query Frame = 3
Query:  531 LGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            +G    HCGW S LESI   VP+IGRPFFGDQ++N RM+E
Sbjct:  342 IGVFVTHCGWNSTLESIFCRVPVIGRPFFGDQKVNARMVE 381          

HSP 3 Score: 29.261 bits (64), Expect = 3.592e-46
Identity = 12/20 (60.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  488 VDWATQVNVLAHEAVGVFVT 547
            V WA Q++VL + A+GVFVT
Sbjct:  328 VSWAPQLHVLENPAIGVFVT 347          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG_SOLME (Anthocyanidin 3-O-glucosyltransferase OS=Solanum melongena GN=GT PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 4.982e-45
Identity = 77/157 (49.04%), Postives = 97/157 (61.78%), Query Frame = 1
Query:   13 IRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPE-LTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            + + D+P  V + DL+   S ML+ M   L KA AV +NSF+ELD + L N    K   K  ++GP  L+L S ++        DE GC+ WLDKQK+K  SV Y+SFGTV T  PNEI +IAEALE  K PFIWSLR+    NLP GFLERT+  G
Sbjct:  169 LSINDIPPEVTAEDLEGPMSSMLYNMALNLHKADAVVLNSFQELDRDPLINKDLQKNLQKVFNIGP--LVLQSSRKL-------DESGCIQWLDKQKEK--SVVYLSFGTVTTLPPNEIGSIAEALETKKTPFIWSLRNNGVKNLPKGFLERTKEFG 314          

HSP 2 Score: 62.003 bits (149), Expect = 4.982e-45
Identity = 27/42 (64.29%), Postives = 32/42 (76.19%), Query Frame = 3
Query:  525 KQLGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            K +G    HCGW SILE I+ GVPMI RPFFGDQ++N RM+E
Sbjct:  329 KSVGVFVTHCGWNSILEGISFGVPMICRPFFGDQKLNSRMVE 370          

HSP 3 Score: 33.113 bits (74), Expect = 4.982e-45
Identity = 13/20 (65.00%), Postives = 17/20 (85.00%), Query Frame = 2
Query:  488 VDWATQVNVLAHEAVGVFVT 547
            V WA Q+ +LAH++VGVFVT
Sbjct:  317 VSWAPQLEILAHKSVGVFVT 336          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UGFGT_MEDTR (Flavonoid 3-O-glucosyltransferase OS=Medicago truncatula GN=UGT78G1 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.889e-44
Identity = 74/160 (46.25%), Postives = 103/160 (64.38%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            G  +++ +DLPEGV+  D+D  F+ MLH+MG +LP+A AV INSF  + P + N L +KF    L+VGPF L     +       + DE+GCL WLD+ +   +SV Y+SFG+V TP P+E+ A+AE+LE    PFIWS R   +  LP GFLERT++ G
Sbjct:  181 GFPELKASDLPEGVIK-DIDVPFATMLHKMGLELPRANAVAINSFATIHPLIENELNSKFK-LLLNVGPFNLTTPQRK-------VSDEHGCLEWLDQHEN--SSVVYISFGSVVTPPPHELTALAESLEECGFPFIWSFRGDPKEKLPKGFLERTKTKG 329          

HSP 2 Score: 49.6766 bits (117), Expect = 6.889e-44
Identity = 21/34 (61.76%), Postives = 24/34 (70.59%), Query Frame = 3
Query:  549 HCGWGSILESIAAGVPMIGRPFFGDQRINGRMME 650
            H GW S+LE I  GVPMI RPFFGDQ +N  + E
Sbjct:  352 HSGWNSVLECIVGGVPMISRPFFGDQGLNTILTE 385          

HSP 3 Score: 30.0314 bits (66), Expect = 6.889e-44
Identity = 12/20 (60.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:  488 VDWATQVNVLAHEAVGVFVT 547
            V WA QV +L H +VGVF+T
Sbjct:  332 VAWAPQVEILKHSSVGVFLT 351          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG2_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.561e-43
Identity = 76/161 (47.20%), Postives = 100/161 (62.11%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPK-AAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            G+   RV DLP+GVVSGD + V S+++H+MG+ LP+ AAAV +N+F  LDP        +     +  GP+ LLLA D   ++A    D +GCLAWL +Q  +   VAYVSFGTVA P P+E+  +A  LEAS  PF+WSLR  S   LP GFL+R    G
Sbjct:  188 GLASYRVRDLPDGVVSGDFNYVISLLVHRMGQCLPRSAAAVALNTFPGLDPPDVTAALAEILPNCVPFGPYHLLLAEDDADTAAPA--DPHGCLAWLGRQPAR--GVAYVSFGTVACPRPDELRELAAGLEASAAPFLWSLREDSWTLLPPGFLDRAAGTG 344          

HSP 2 Score: 52.7582 bits (125), Expect = 2.561e-43
Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 3
Query:  531 LGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGR 641
            +G+   H GW S+LE +++GVPM  RPFFGDQR+N R
Sbjct:  363 VGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNAR 399          

HSP 3 Score: 30.4166 bits (67), Expect = 2.561e-43
Identity = 14/22 (63.64%), Postives = 15/22 (68.18%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            L V WA QV VL H +VG FVT
Sbjct:  347 LVVPWAPQVAVLRHPSVGAFVT 368          
BLAST of FC929525 vs. ExPASy Swiss-Prot
Match: UFOG3_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 7.322e-43
Identity = 75/161 (46.58%), Postives = 100/161 (62.11%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPK-AAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDG 480
            G+   RV DLP+GVVSGD + V ++++H+MG+ LP+ AAAV +N+F  LDP        +     +  GP+ LLLA D   ++A    D +GCLAWL +Q  +   VAYVSFGTVA P P+E+  +A  LEAS  PF+WSLR  S   LP GFL+R    G
Sbjct:  188 GLASYRVRDLPDGVVSGDFNYVINLLVHRMGQCLPRSAAAVALNTFPGLDPPDVTAALAEILPNCVPFGPYHLLLAEDDADTAAPA--DPHGCLAWLGRQPAR--GVAYVSFGTVACPRPDELRELAAGLEASGAPFLWSLREDSWTLLPPGFLDRAAGTG 344          

HSP 2 Score: 52.7582 bits (125), Expect = 7.322e-43
Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 3
Query:  531 LGSL*XHCGWGSILESIAAGVPMIGRPFFGDQRINGR 641
            +G+   H GW S+LE +++GVPM  RPFFGDQR+N R
Sbjct:  363 VGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNAR 399          

HSP 3 Score: 30.4166 bits (67), Expect = 7.322e-43
Identity = 14/22 (63.64%), Postives = 15/22 (68.18%), Query Frame = 2
Query:  482 LXVDWATQVNVLAHEAVGVFVT 547
            L V WA QV VL H +VG FVT
Sbjct:  347 LVVPWAPQVAVLRHPSVGAFVT 368          
The following BLAST results are available for this feature:
BLAST of FC929525 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
UFOG7_MANES3.163e-6762.35Anthocyanidin 3-O-glucosyltransferase 7 (Fragment)... [more]
UGFGT_ARATH2.479e-6359.88Flavonoid 3-O-glucosyltransferase OS=Arabidopsis t... [more]
UFOG_VITVI1.070e-6056.17Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis v... [more]
KGLT_PETHY2.719e-5857.50Kaempferol 3-O-beta-D-galactosyltransferase OS=Pet... [more]
FORT_ARATH3.839e-5351.23Flavonol-3-O-glucoside L-rhamnosyltransferase OS=A... [more]
UFOG_GENTR3.592e-4645.00Anthocyanidin 3-O-glucosyltransferase OS=Gentiana ... [more]
UFOG_SOLME4.982e-4549.04Anthocyanidin 3-O-glucosyltransferase OS=Solanum m... [more]
UGFGT_MEDTR6.889e-4446.25Flavonoid 3-O-glucosyltransferase OS=Medicago trun... [more]
UFOG2_MAIZE2.561e-4347.20Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]
UFOG3_MAIZE7.322e-4346.58Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AB08RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AB08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929525 ID=FC929525|Name=FC929525|organism=Citrus clementina|type=EST|length=652bp
GGAATGAATAAGATACGCGTCGCCGACTTGCCTGAAGGAGTTGTTTCCGG
AGACTTGGATTCAGTCTTTTCTGTTATGCTGCATCAAATGGGACGTCAGC
TACCCAAGGCAGCTGCTGTTTTCATCAACAGTTTTGAAGAGTTAGACCCT
GAGTTGACAAATCATCTCAAGACTAAATTCAACAACAAGTTTCTCAGTGT
TGGCCCTTTCAAGCTACTACTAGCATCTGATCAGCAACCGTCGTCCGCAA
CTGATTTGGATGATGAATATGGTTGCCTGGCGTGGCTGGACAAGCAGAAG
AAGAAACCTGCTTCAGTGGCGTATGTCAGCTTTGGTACAGTGGCAACACC
ATCTCCAAACGAAATTGTGGCAATAGCAGAGGCCTTGGAAGCAAGTAAAG
TGCCATTTATTTGGTCACTGAGACATAGGTCGCAGGCAAATCTGCCAAAT
GGGTTCCTGGAAAGGACAAGATCTGATGGAATTGTNGGTGGATTGGGCCA
CCCAGGTCAATGTTTTAGCACATGAAGCAGTTGGGGTCTTTGTAACANCA
TTGTGGTTGGGGCTCAATCCTTGAAAGCATAGCTGCAGGTGTGCCGATGA
TCGGGAGGCCATTCTTTGGGGATCAGCGGATTAATGGAAGAATGATGGAA
CA
back to top