FC929528

Overview
NameFC929528
Unique NameFC929528
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length954
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.692e-80
Identity = 139/242 (57.44%), Postives = 171/242 (70.66%), Query Frame = 3
Query:  171 KIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYC--NLNYPCR-GK-YYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            KIISR MF+ +L +RN+  CPA+GFYTYDAF+ AAK+FP+FG +G+  +R RE+AAF  QT HETTGGW  AP G YAWGYCF+ E +P S YC  +  YPC  GK YYGRGP+QL+WNYNY  C                 ATD VLSFK+A+WFWMT Q PKPSCH+V+T  W+PSA D  AGRLPGYG+ TN++NGG+ECG+G N  V +R+GFF  +CG  G+  G NLDCY+    G
Sbjct:    4 KIISRSMFDQMLKHRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNYGPCGEALRVNLLGNPDLV--ATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGVGTGNNLDCYNQRPFG 243          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 298.516 bits (763), Expect = 3.692e-80
Identity = 137/241 (56.85%), Postives = 168/241 (69.71%), Query Frame = 3
Query:  159 GELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYC--NLNYPCRG--KYYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYH 869
            G+L  IIS   F+D+L +RND  CPARGFYTY+AFI AAK+FP FG +G+   R +E+AAFF QT HETTGGW  AP G Y+WGYCF  E +P S YC  +  +PC    +YYGRGP+QL+WNYNY  C                 A D V++FK+AIWFWMTAQPPKPSCH VI  +W+PS  D  AGRLPGYG+ TNIINGG+ECG+G +  V +RIGF+  +C  FG+ PG NLDCY+
Sbjct:   84 GDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLV--ANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGVNPGGNLDCYN 322          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 3.125e-79
Identity = 136/241 (56.43%), Postives = 167/241 (69.29%), Query Frame = 3
Query:  159 GELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYC--NLNYPCRG--KYYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYH 869
            G+L  IISR  F+D+L +RND  CPARGFYTYDAFI AAK+FP FG +G+   R +EIAAFF QT HETTGGW  AP G Y+WGYCF  E +P S YC  +  +PC     YYGRGP+QL+WNYNY +C                 + DPV++FK+AIWFWMT Q PKPSCH VI  +W+PS  D  AGR+PGYG+ TNIINGG+ECG+G +  V +RIGF+  +C   G+ PG NLDCY+
Sbjct:   69 GDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQC--GRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGFYQRYCNILGVNPGGNLDCYN 307          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 3.125e-79
Identity = 144/255 (56.47%), Postives = 174/255 (68.24%), Query Frame = 3
Query:  123 CGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGG--WRDAPGGEYAWGYCFISEISPPSPYCNL--NYPCR-GK-YYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYH 869
            C  + +G G D G L  +I+RE F+ +L +RND  CPARGFYTYDAFI AAK+FPAF  +G++  R RE+AAF AQT HETTGG  W  AP G Y WGYC+  E++P + YC    NYPC  GK Y+GRGP+QLTWNYNY +C                 ATDP +SFKSA WFWMT Q PKPSCH+VI   W PS +D  AGR+PG+GL TNIINGG+ECGQGWN  V +RIGF+  +C   G+  G NLDCY+
Sbjct:   58 CQSQCSGSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNP-ADYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLLNNPDLL--ATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVGYGNNLDCYN 308          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 5.331e-79
Identity = 144/264 (54.55%), Postives = 175/264 (66.29%), Query Frame = 3
Query:  105 CGSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYCNLN--YPCRG--KYYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            CG G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AAKA+P+FGN+G+   R REIAAF  QT HETTGGW  AP G YAWGYCF+ E +P S YC+    +PC    +YYGRGPIQ++WNYNY +C                 ATD V+SFKSA+WFWMTAQ PKPS H+VIT  W PS+ DV A RLPGYG  TNIINGG+ECG+G +  V++RIGFF  +C   G+  G NLDCY  +  G
Sbjct:   58 CGPG--CQSQCGGPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNP-STYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLV--ATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQTPFG 316          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 6.962e-79
Identity = 143/255 (56.08%), Postives = 174/255 (68.24%), Query Frame = 3
Query:  138 TGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGG--WRDAPGGEYAWGYCFISEISPPSPYC--NLNYPCR-GK-YYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            +G     G L  +ISRE F  +L +RND  CPARGFYTYDAFI AA++FPAF  +G++  R REIAAF AQT HETTGG  W  AP G YAWGYC+  E++PPS YC  + NYPC  GK Y+GRGP+QL+WNYNY +C                 ++DP +SFKSA WFWMT Q PKPSCH VI   W PS++D  AGR+PGYG+ TNIINGG+ECG+GWN  V +RIGF+  +C   G+  G NLDCY+ S  G
Sbjct:   65 SGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLL--SSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFG 316          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 1.551e-78
Identity = 145/269 (53.90%), Postives = 176/269 (65.43%), Query Frame = 3
Query:  105 CGS-----GVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYCNLN--YPCRG--KYYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            CGS     G  C  +  G      +L  +ISR  F+ +L +RND  CPA+GFYTYDAFI AAKA+P+FGN+G+   R REIAAF  QT HETTGGW  AP G YAWGYCF+ E +P S YC+    +PC    +YYGRGPIQ++WNYNY +C                 ATD V+SFKSA+WFWMTAQ PKPS H+VIT  W PS+ DV A RLPGYG  TNIINGG+ECG+G +  V++RIGFF  +C   G+  G NLDCY  +  G
Sbjct:   50 CGSTTDYCGKDCQSQCGGPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNP-SAYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLV--ATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGYGNNLDCYSQTPFG 315          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 2.646e-78
Identity = 149/258 (57.75%), Postives = 169/258 (65.50%), Query Frame = 3
Query:  126 GERDTGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYC--NLNYPC-RGKYY-GRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGW-NDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            G  D G   D G L  II +  F+ LL +RND RCPA GFYTY+AFI AAK FP FGN+G++ MR REIAAF  QT HETTGGW DAP G YAWGYC++ EI+   PYC  + NY C  GK Y GRGPIQL+WNYNY  C                  TDPV+SFK+AIWFWM  Q PKPSCH VIT  W PSA D+ AGR+PGYG+ TNIINGGIECGQG  N A  +RIGF+  +C   G   G NLDCY     G
Sbjct:   76 GGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEIN-CQPYCDPSSNYQCVAGKQYCGRGPIQLSWNYNYGLC--GDDLKLPLLQEPELVETDPVISFKTAIWFWMKPQSPKPSCHAVITGNWTPSAADLEAGRVPGYGVITNIINGGIECGQGGPNAANEDRIGFYKKYCDSLGTTYGSNLDCYQQRPFG 330          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 1.005e-77
Identity = 142/255 (55.69%), Postives = 172/255 (67.45%), Query Frame = 3
Query:  138 TGHGTDGGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGG--WRDAPGGEYAWGYCFISEISPPSPYC--NLNYPCR-GK-YYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            +G     G L  +ISRE F  +L +RND  CPARGFYTYDAFI AA++FPAF  +G++  R REIAAF AQT HETTGG  W  AP G YAWGYC+  E++PPS YC  + NYPC  GK Y+GRGP+QL+WNYNY +C                 ++DP +SFKSA WFWMT Q PKPSCH VI   W PS++D  AGR  GYG+ TNIINGG+ECG+GWN  V +RIGF+  +C   G+  G NLDCY+ S  G
Sbjct:   43 SGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLL--SSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFG 294          
BLAST of FC929528 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 288.886 bits (738), Expect = 2.925e-77
Identity = 136/247 (55.06%), Postives = 168/247 (68.02%), Query Frame = 3
Query:  156 GGELGKIISREMFEDLLPYRNDVRCPARGFYTYDAFIEAAKAFPAFGNSGNETMRTREIAAFFAQTGHETTGGWRDAPGGEYAWGYCFISEISPPSPYCNLN--YPCRG--KYYGRGPIQLTWNYNYLRCXXXXXXXXXXXXXXXXXATDPVLSFKSAIWFWMTAQPPKPSCHEVITDEWKPSANDVXAGRLPGYGLTTNIINGGIECGQGWNDAVRNRIGFFSTFCGKFGIRPGYNLDCYHNSLLG 884
            GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FP FG SG+ T R REIAAFFAQT HETTGGW  AP G YAWGYC++ E   P  YC  +  +PC    KY+GRGPIQ++ NYNY  C                 ATDPV+SFKSA+WFWMT Q PKPSCH+VI   W+PSA D  A RLPG+G+ TNIINGG+ECG+G +  V++RIGF+  +C   G+ PG NLDC +    G
Sbjct:   77 GGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLV--ATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFG 321          
The following BLAST results are available for this feature:
BLAST of FC929528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHIT_CARPA3.692e-8057.44Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHIB_ARATH3.692e-8056.85Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_BRANA3.125e-7956.43Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHI1_THECC3.125e-7956.47Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIT_PHAVU5.331e-7954.55Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI1_GOSHI6.962e-7956.08Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI5_PHAVU1.551e-7853.90Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI6_POPTR2.646e-7857.75Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI2_GOSHI1.005e-7755.69Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI1_TOBAC2.925e-7755.06Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AB11RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AB11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929528 ID=FC929528; Name=FC929528; organism=Citrus clementina; type=EST; length=954bp
GGATAATTGATATCATAACTGTTGCTTTCAAAATGAGGCTTATTGCGTCC
TTACTAGTTTTCTCTCTAGTTTTATCTTTCGTACTAGGAGGCTCAGCACG
GAATTGTGGAAGCGGCGTTGTGTGCGGTGAACGTGATACCGGCCACGGGA
CGGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTTTGAAGAC
TTGCTTCCGTATAGAAATGATGTACGATGCCCTGCCAGAGGCTTCTACAC
TTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTTTGGTAACT
CTGGAAATGAAACCATGCGTACAAGAGAAATTGCTGCCTTTTTTGCCCAA
ACTGGCCATGAAACTACTGGGGGATGGCGCGATGCACCTGGTGGAGAATA
TGCTTGGGGATATTGCTTTATAAGCGAAATTAGCCCTCCGTCCCCCTACT
GTAATCTTAACTATCCATGTCGAGGGAAGTACTATGGCCGAGGTCCAATT
CAACTCACTTGGAATTACAATTACTTACGGTGCGGAGAAGACCTAGGGCT
AGGAGAGGAGTTGTTGAACAATCCAGACCTTCTTGCTACTGATCCAGTAC
TATCATTCAAGTCAGCAATCTGGTTCTGGATGACCGCACAGCCACCAAAG
CCATCATGCCACGAAGTCATTACCGACGAATGGAAACCATCAGCAAATGA
CGTANACGCCGGCCGGCTTCCGGGATACGGTCTAACCACAAATATAATCA
ACGGTGGAATTGAATGTGGCCAAGGTTGGAATGACGCTGTACGTAACCGT
ATTGGGTTCTTTAGCACTTTCTGTGGCAAGTTTGGGATTCGCCCTGGTTA
CAATCTTGATTGCTACCACAACAGCCTTTTGGGCTTATTCTGATGGCACG
ATCTATGTGATCATCATGATCAACGTTTTAGTAAAATAAGCTTAATAAAA
GCTA
back to top