FC929535

Overview
NameFC929535
Unique NameFC929535
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length872
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929535_ssr12 microsatellite FC929535_ssr12:12..21. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14184 contig Ccv1_Contig14184:128..999. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E13L3_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 3 OS=Arabidopsis thaliana GN=At5g08000 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 5.046e-33
Identity = 58/87 (66.67%), Postives = 72/87 (82.76%), Query Frame = 2
Query:  188 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            H++A+WCVCK G+ D VLQK LDYACG GADCNP H  G C+NP+ V+AHC+YAVNS+FQ+KGQA  SC+F+G+AT+ TTDPS  GC
Sbjct:   16 HTSASWCVCKTGLSDSVLQKTLDYACGNGADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTGC 102          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E13L2_ARATH (Glucan endo-1,3-beta-glucosidase-like protein 2 OS=Arabidopsis thaliana GN=At5g61130 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.591e-29
Identity = 53/87 (60.92%), Postives = 67/87 (77.01%), Query Frame = 2
Query:  188 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            HS+A+WCVCK G+ D VLQ  LDYACG GADCNP      C+NP+ V++HC+YAVNS+FQ+KGQ+ GSC+F G+AT   +DPS  GC
Sbjct:   16 HSSASWCVCKTGLSDTVLQATLDYACGNGADCNPTKPKQSCFNPDNVRSHCNYAVNSFFQKKGQSPGSCNFDGTATPTNSDPSYTGC 102          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E13L4_ARATH (Glucan endo-1,3-beta-glucosidase-like protein At1g69295 OS=Arabidopsis thaliana GN=At1g69295 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.538e-24
Identity = 49/85 (57.65%), Postives = 63/85 (74.12%), Query Frame = 2
Query:  188 HSTANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTA 442
            +S A +C+CK+G  + VLQKA+DYACG GADC  I   G CY PNTVK HC  AVNSY+Q+K  +  +CDF+G+A+ +TT PSTA
Sbjct:   16 YSNAAYCLCKEG-NEQVLQKAIDYACGNGADCTQIQPTGACYQPNTVKNHCDVAVNSYYQKKASSGATCDFNGAASPSTTPPSTA 99          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 8.356e-20
Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = 2
Query:  203 WCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            +C+  DGV    LQ ALD+ACG G ++C+ I     CY PN VK H S+A NSY+Q++G+A GSCDF G A + TTDPS   C
Sbjct:  272 YCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPSHGSC 354          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.238e-19
Identity = 39/82 (47.56%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  203 WCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            WCV KDG     LQ  ++YACG   DC PI S G C++PN+++AH SY +N+Y+Q  G    +CDF G+  V ++DPS  GC
Sbjct:  377 WCVAKDGANGTDLQNNINYACGF-VDCKPIQSGGACFSPNSLQAHASYVMNAYYQANGHTDLACDFKGTGIVTSSDPSYGGC 457          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.688e-18
Identity = 42/83 (50.60%), Postives = 55/83 (66.27%), Query Frame = 2
Query:  203 WCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            +C+ K+ V   +LQ ALD+ACG G  DC+ +     CY P+ V AH +YA N+Y+Q+ G+A GSCDF G ATV TTDPS   C
Sbjct:  360 FCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTC 442          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 5.069e-17
Identity = 38/86 (44.19%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  191 STANWCVCKDGVGDPVLQKALDYACGAGADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            +++ WCV K G  +  LQ +LD+ACG G DC  I   G C+ PN V +H +YA+N YFQ+  +    CDFS +ATV + +PS   C
Sbjct:  360 TSSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNC 445          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.633e-15
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  203 WCVCKDGVGDPVLQKALDYACGAGA-DCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            +C  ++G    +LQ ALD+ACG G  DC+PI     CY P+ V AH +YA ++Y+ + G    +C+F+G A++ TTDPS   C
Sbjct:  368 YCTAREGADTKMLQAALDWACGPGKIDCSPIKQGETCYEPDNVVAHANYAFDTYYHQTGNNPDACNFNGVASITTTDPSHGTC 450          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.380e-14
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  194 TANWCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            T  WC+         LQ ALD+ACG G  DC+ +  + PC+ P+TV +H SYA N+Y+Q+ G +   C F+G++     DPS   C
Sbjct:  388 TKKWCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNC 473          
BLAST of FC929535 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.803e-14
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 2
Query:  188 HSTANWCVCKDGVGDPVLQKALDYACGAG-ADCNPIHSNGPCYNPNTVKAHCSYAVNSYFQRKGQAQGSCDFSGSATVATTDPSTAGC 448
            + ++ +CV K    D  L   L++ACG G A+C  I    PCY PN VK+H S+A N Y+Q+   A G+CDF G+A   T DPS   C
Sbjct:  357 NGSSMFCVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTC 444          
The following BLAST results are available for this feature:
BLAST of FC929535 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
E13L3_ARATH5.046e-3366.67Glucan endo-1,3-beta-glucosidase-like protein 3 OS... [more]
E13L2_ARATH2.591e-2960.92Glucan endo-1,3-beta-glucosidase-like protein 2 OS... [more]
E13L4_ARATH9.538e-2457.65Glucan endo-1,3-beta-glucosidase-like protein At1g... [more]
E131_ARATH8.356e-2051.81Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E13B_WHEAT9.238e-1947.56Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E133_ARATH2.688e-1850.60Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E137_ARATH5.069e-1744.19Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E132_ARATH3.633e-1542.17Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis ... [more]
E1312_ARATH1.380e-1439.53Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E134_ARATH1.803e-1443.18Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AC07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AC07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929535 ID=FC929535|Name=FC929535|organism=Citrus clementina|type=EST|length=872bp
GAACTTTTTCATCTCTCTCTCAGTCCCTCTCAAAGGCCTCAGCTTAGCTG
CTGTGTGTGTTGTGACAAACTTTTCTCGGAGCCAAACAAGCAAGTATTTG
TTATTATTATCTCTTCTCTAAGCTTCTTTTGCTCATTCAGTGATGGCTGT
TTTGGTGCTTTTAGCTCTCTTCCTTGGCTTCACTGGGCATTCAACTGCAA
ACTGGTGTGTTTGCAAAGATGGAGTGGGTGACCCAGTTTTACAAAAAGCT
TTGGACTATGCTTGTGGAGCTGGGGCTGATTGTAACCCTATCCATTCCAA
TGGGCCTTGTTACAACCCCAACACTGTCAAAGCTCACTGCAGTTATGCTG
TCAACAGCTATTTCCAGAGAAAGGGTCAAGCTCAAGGCTCTTGTGATTTT
TCCGGAAGTGCAACCGTTGCCACTACCGATCCCAGCACTGCTGGCTGTTC
TTATCCTTCAAGTGCCAGCACTTCAGGCACCACCTCAACAACACCAGTCA
CAGGTACTCCAGGCACAACCACACCCACAACAACTCCGTCCACTACCACT
CCAACGACTAACACACCAGGCAGCACCACACCAGGCAGCACCACTCCGGG
CAGCACCACTCCGTACACCACCACACCATCAACTGGAACTGGAGTGTTGG
GAGGAGTTGGTCCTGGTTTAGGCCCTTCGGGATCTGGTATGCCCAACACA
GACTATAGTCATGGTGGGATGAGACTGCAAAACTCTGCCTTGTCTTTTTT
GGTCGTCCTCTTGTTCTCAGGCTCGATGCTCTTGTGGGGGTGAAAGAAAC
AATCAACATGACATCTACTAGGATGGAGATGTGGTACTATAGTCAGTGTC
CTTGATGCTGGATCTCAATGTG
back to top