FC929541

Overview
NameFC929541
Unique NameFC929541
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length871
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929541_ssr719 microsatellite FC929541_ssr719:719..733. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig1059 contig Ccv1_Contig1059:16..886. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF92_ARATH (Ethylene-responsive transcription factor 1B OS=Arabidopsis thaliana GN=ERF1B PE=2 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 8.518e-49
Identity = 109/182 (59.89%), Postives = 129/182 (70.88%), Query Frame = 3
Query:  159 NNY-LPFNENDSEEMLLYGLIAEATPEATSEALVSSKRIKEEEVSSTTEENPTKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVERVQESLKDMKCNTEEGCSPVVALKRKHSMRRKMVTNNKKHKERD----NLRIENFVVLEDLGADY 689
            NNY LPFNENDSEEM LYGLI ++T +   ++   S+ +  + VSS   E     KSYRGVRRRPWGKFAAEIRDSTR+GIRVWLGTF+S            FSMRGSSAILNF  ERVQESL ++K   E+GCSPVVALKRKHSMRR+M   NKK K+ D    +++++N VV EDLG  Y
Sbjct:   32 NNYSLPFNENDSEEMFLYGLIEQSTQQTYIDS--DSQDLPIKSVSSRKSE-----KSYRGVRRRPWGKFAAEIRDSTRNGIRVWLGTFESAEEAALAYDQAAFSMRGSSAILNFSAERVQESLSEIKYTYEDGCSPVVALKRKHSMRRRM--TNKKTKDSDFDHRSVKLDNVVVFEDLGEQY 204          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF94_ARATH (Ethylene-responsive transcription factor ERF094 OS=Arabidopsis thaliana GN=ERF094 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.670e-28
Identity = 66/131 (50.38%), Postives = 84/131 (64.12%), Query Frame = 3
Query:  213 LIAEATPEATSEALVSSKRIKEEEVSSTTEENPTKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVERVQESLKDMK-CNTEEGCSPVVALKRKHSMRRK 602
            L++  T     +       I +EE    T     +EKSYRGVR+RPWGKFAAEIRDSTR GIRVWLGTFD+            F+++GS A+LNFP + V+ESL+ M+  N  +G SPV+ALKRKHSMR +
Sbjct:   44 LLSSPTDNYCDDFFAFESSIIKEEGKEATVAAEEEEKSYRGVRKRPWGKFAAEIRDSTRKGIRVWLGTFDTAEAAALAYDQAAFALKGSLAVLNFPADVVEESLRKMENVNLNDGESPVIALKRKHSMRNR 174          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF93_ARATH (Ethylene-responsive transcription factor 15 OS=Arabidopsis thaliana GN=ERF15 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.849e-28
Identity = 67/124 (54.03%), Postives = 86/124 (69.35%), Query Frame = 3
Query:  243 SEALVSSKRIKEEEVSSTTEENPT---KEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVERVQESLKDMK-CNTEEGCSPVVALKRKHSMRRK 602
            S  ++  + I+  +VS++ EE      +E+SYRGVR+RPWGKFAAEIRDSTR+GIRVWLGTFD             F+ +GS A LNFPVE V+ESLK M+  N  +G SPV+ALKRKHS+R +
Sbjct:   55 SPEMMIKEEIQNGDVSNSEEEEKVGIDEERSYRGVRKRPWGKFAAEIRDSTRNGIRVWLGTFDKAEEAALAYDQAAFATKGSLATLNFPVEVVRESLKKMENVNLHDGGSPVMALKRKHSLRNR 178          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: EF101_ARATH (Ethylene-responsive transcription factor 2 OS=Arabidopsis thaliana GN=ERF2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.373e-21
Identity = 57/128 (44.53%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEATPEATSEALVS------SKRIKEEEVSSTTEENP----------TKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPV 503
            LP  ENDSE+ML+YGL+ +A    TS + +S      + +++  E  +  EE P           K K YRGVR+RPWGKFAAEIRD  ++G RVWLGTF++            F MRGS A+LNFP+
Sbjct:   48 LPLKENDSEDMLVYGLLKDAFHFDTSSSDLSCLFDFPAVKVEPTENFTAMEEKPKKAIPVTETAVKAKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDIAAFRMRGSRALLNFPL 175          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: PTI5_SOLLC (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum GN=PTI5 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.282e-20
Identity = 54/119 (45.38%), Postives = 69/119 (57.98%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEATPEATSEALVSSKRIKEEEVSSTTEENPTKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVERVQESL 524
            LP NENDS+EM+LY ++ EA           ++ +    +    +      K YRGVRRRPWGK+AAEIRDS RHG RVWLGTF++            F MRG+ A+LNFP E V  S+
Sbjct:    9 LPLNENDSQEMVLYEVLNEANALNIPYLPQRNQLLPRNNILRPLQ---CIGKKYRGVRRRPWGKYAAEIRDSARHGARVWLGTFETAEEAALAYDRAAFRMRGAKALLNFPSEIVNASV 124          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: EF100_ARATH (Ethylene-responsive transcription factor 1A OS=Arabidopsis thaliana GN=ERF1A PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.855e-20
Identity = 59/138 (42.75%), Postives = 75/138 (54.35%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEA-------------------------TPEATSEALVSSKRIKEEEVSSTTEE-NPTKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPV 503
            LP  ENDSE+ML+YG++ +A                         TPE  S A V S  +K+E+ S  +      K K YRGVR+RPWGKFAAEIRD  ++G RVWLGTF++            F MRGS A+LNFP+
Sbjct:   71 LPLKENDSEDMLVYGILNDAFHGGWEPSSSSSDEDRSSFPSVKIETPE--SFAAVDSVPVKKEKTSPVSAAVTAAKGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPL 206          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF1_SOLLC (Ethylene-responsive transcription factor 1 OS=Solanum lycopersicum GN=ERF1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.870e-20
Identity = 56/125 (44.80%), Postives = 72/125 (57.60%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEA-----TPE-ATSEALVSSKRIKEEEVSSTTEENPT--------KEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFP 500
            LP   NDSE+M++YG + +A     TP   TSE +    R + E   ST+   PT        K + YRGVR+RPWGKFAAEIRD  ++G RVWLGT++S            F MRG+ A+LNFP
Sbjct:   40 LPLKVNDSEDMVIYGFLQDAFSIGWTPSNLTSEEVKLEPREEIEPAMSTSVSPPTVAPAALQPKGRHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYESAEEAALAYGKAAFRMRGTKALLNFP 164          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF1_TOBAC (Ethylene-responsive transcription factor 1 OS=Nicotiana tabacum GN=ERF1 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.385e-19
Identity = 63/165 (38.18%), Postives = 86/165 (52.12%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEA-----TPEATSEALVSSKRIKEEEVSSTTEEN--PTKE----KSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVERVQESLKDMKCNTEEGCSPVVALKRKHS---MRRKMVTNNK 620
            LP   +DSE+M++Y L+ +A     +P   S   V S++ +EE V S  E    P  E    + YRGVRRRPWGKFAAEIRD  ++G RVWLGT+++            + MRGS A LNFP        + ++   +   SP  A   ++S    RRK V   K
Sbjct:   41 LPLKVDDSEDMVIYTLLKDALNVGWSPFNFSAGEVKSEQREEEIVVSPAETTAAPAAELPRGRHYRGVRRRPWGKFAAEIRDPAKNGARVWLGTYETDEEAAIAYDKAAYRMRGSKAHLNFPHRIGLNEPEPVRVTAKRRASPEPASSSENSSPKRRRKAVATEK 205          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF2_NICSY (Ethylene-responsive transcription factor 2 OS=Nicotiana sylvestris GN=ERF2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.185e-19
Identity = 51/129 (39.53%), Postives = 72/129 (55.81%), Query Frame = 3
Query:  168 LPFNENDSEEMLLYGLIAEATPEATSEALVSSKRIK---EEEVSSTTEENPT---------------KEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFP 500
            LP   +DSE+M++YGL+++A     +   ++S  IK    EE+   T   P+               K + YRGVR+RPWGKFAAEIRD  ++G RVWLGT+++            + MRGS A+LNFP
Sbjct:   32 LPLKVDDSEDMVIYGLLSDALTTGWTPFNLTSTEIKAEPREEIEPATSPVPSVAPPAETTTAQAVVPKGRHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTYETAEEAALAYDKAAYRMRGSKALLNFP 160          
BLAST of FC929541 vs. ExPASy Swiss-Prot
Match: ERF5_TOBAC (Ethylene-responsive transcription factor 5 OS=Nicotiana tabacum GN=ERF5 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.567e-18
Identity = 44/79 (55.70%), Postives = 54/79 (68.35%), Query Frame = 3
Query:  270 IKEEEVSSTTEENPTKEKSYRGVRRRPWGKFAAEIRDSTRHGIRVWLGTFDSXXXXXXXXXXXXFSMRGSSAILNFPVE 506
            +K++EV    E  PT++K YRGVR+RPWGKFAAEIRD  R G RVWLGTFD+            F +RGS AI+NFP+E
Sbjct:  126 MKQQEVVQKVEVVPTEKKHYRGVRQRPWGKFAAEIRDPNRKGTRVWLGTFDTAIEAAKAYDRAAFKLRGSKAIVNFPLE 204          
The following BLAST results are available for this feature:
BLAST of FC929541 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
ERF92_ARATH8.518e-4959.89Ethylene-responsive transcription factor 1B OS=Ara... [more]
ERF94_ARATH1.670e-2850.38Ethylene-responsive transcription factor ERF094 OS... [more]
ERF93_ARATH2.849e-2854.03Ethylene-responsive transcription factor 15 OS=Ara... [more]
EF101_ARATH3.373e-2144.53Ethylene-responsive transcription factor 2 OS=Arab... [more]
PTI5_SOLLC1.282e-2045.38Pathogenesis-related genes transcriptional activat... [more]
EF100_ARATH2.855e-2042.75Ethylene-responsive transcription factor 1A OS=Ara... [more]
ERF1_SOLLC4.870e-2044.80Ethylene-responsive transcription factor 1 OS=Sola... [more]
ERF1_TOBAC5.385e-1938.18Ethylene-responsive transcription factor 1 OS=Nico... [more]
ERF2_NICSY9.185e-1939.53Ethylene-responsive transcription factor 2 OS=Nico... [more]
ERF5_TOBAC1.567e-1855.70Ethylene-responsive transcription factor 5 OS=Nico... [more]

Pages

back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH2DA02RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2DA02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929541 ID=FC929541|Name=FC929541|organism=Citrus clementina|type=EST|length=871bp
GCAACACAACTAGGGAAAAAACAGAGTGAAAAACAGAGTCTCAGAACCTG
AACACACACTCTCATCAAATCCTAATGGATTCCTTGTTCTTCCACTCTCC
AAATTCAATTTCCTCATCGGAATCCTCTTTCGGGTCACCGGAGTCTTTCC
CTTTTTATAACAATTATCTTCCATTCAATGAAAATGACTCAGAAGAAATG
CTTCTCTATGGACTAATAGCAGAAGCCACACCGGAAGCAACATCAGAAGC
ACTAGTAAGCTCCAAGAGAATTAAAGAAGAAGAGGTGAGTTCAACAACAG
AGGAAAACCCCACCAAGGAAAAGTCATATAGAGGCGTTCGACGGCGGCCG
TGGGGGAAATTTGCAGCAGAAATAAGAGATTCAACTAGGCATGGGATTAG
GGTTTGGCTAGGGACATTCGATAGTGCTGAAGCAGCTGCTTTGGCTTACG
ATCAAGCTGCTTTCTCAATGAGGGGCTCTTCAGCTATACTCAATTTTCCC
GTTGAAAGGGTTCAAGAATCACTTAAAGACATGAAGTGTAACACCGAGGA
GGGATGCTCACCTGTGGTTGCACTAAAGAGGAAACATTCTATGAGAAGAA
AAATGGTGACTAATAATAAGAAGCATAAAGAGAGAGATAATTTGAGGATT
GAAAATTTTGTGGTGTTGGAAGATTTAGGAGCAGATTACTTGGAAGAGCT
GCTAAGTTCATCTGAAAGTACTACTACTACTACAGCAAGACCTCGCTAAT
TGGTGAATTAGATAATAAGTCAACTACTTGTAACTTTCTGGCCTTATCTT
AATCTTCTTGCCCTTTTTTTTTTTTTTTAATTTAGTTATTGTCGTTATCT
TCTTTTTCAATATGTAAACAA
back to top