FC929542

Overview
NameFC929542
Unique NameFC929542
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length798
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15044 contig Ccv1_Contig15044:1..798. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_DANRE (BRCA1-A complex subunit BRE OS=Danio rerio GN=bre PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.622e-13
Identity = 46/145 (31.72%), Postives = 76/145 (52.41%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P+++ +L     + +P +  G C+ +Y+P + + L  +V   +     RR +I A    FG  + E D+V + K    +    F FLV   L   FP+ QP+L  QS  +F S G  + S +   YP+SPRW+ ++MA+R
Sbjct:  221 KLYLSPSIEHALGGSSALHIPAFPSGGCLIDYVPQVCQLLTNKVQYVIQGYHKRREYIAAFLSHFGMGVVEYDAVGFTKLTLLLMWKDFCFLVHVDLPLYFPRDQPTLTFQSIYHFTSSGQ-LYSQVQKSYPYSPRWDGNEMAKR 364          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_XENTR (BRCA1-A complex subunit BRE OS=Xenopus tropicalis GN=bre PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.279e-12
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P + + L  +V   +     RR +I A    FG  + E D+  + K    ++   F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLFLSPRIEHALGGSSALHIPAFPSGSCLIDYVPQVCQLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLSWKDFCFLVHIDLPLYFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_BRAFL (BRCA1-A complex subunit BRE OS=Branchiostoma floridae GN=BRE PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.299e-12
Identity = 41/143 (28.67%), Postives = 74/143 (51.75%), Query Frame = 1
Query:  145 VKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFN-SQGMPIKSPLLTDYPWSPRWEHSQMAERTFEFLVDESVNFKK 567
            +++P +  G C+ +Y+P +++ L++Q+   V   + RR ++ A    FG  + E D+  + K    +    F F++   L ++FP+  P    QS  + + + G P  S +   YP+SPRW   +MA R   F++D    FKK
Sbjct:  234 LRIPRFPTGGCLMDYVPQVQDFLQKQIDHIVEGYQRRREYVAAFISRFGGSVLEYDAESFTKLSLVLEWNEFFFVLHIELPSRFPQDMPVFTFQSCYHLSKTNGEPYVS-VQKSYPYSPRWTGEEMAHRAKLFILDFIPQFKK 375          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_CHICK (BRCA1-A complex subunit BRE OS=Gallus gallus GN=BRE PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.124e-11
Identity = 44/145 (30.34%), Postives = 74/145 (51.03%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P + + L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCQLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLYFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_RAT (BRCA1-A complex subunit BRE OS=Rattus norvegicus GN=Bre PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.731e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKEFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_SAGOE (BRCA1-A complex subunit BRE OS=Saguinus oedipus GN=BRE PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_PONAB (BRCA1-A complex subunit BRE OS=Pongo abelii GN=BRE PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_MOUSE (BRCA1-A complex subunit BRE OS=Mus musculus GN=Bre PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_MESAU (BRCA1-A complex subunit BRE OS=Mesocricetus auratus GN=Bre PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
BLAST of FC929542 vs. ExPASy Swiss-Prot
Match: BRE_HUMAN (BRCA1-A complex subunit BRE OS=Homo sapiens GN=BRE PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 44/145 (30.34%), Postives = 73/145 (50.34%), Query Frame = 1
Query:   97 KLMSTPALK-SLFSVDDVKLPPWLDGMCMAEYLPHLEETLERQVSEAVSLIEVRRRFIEALAPLFGRPI-ETDSVFYRKSMFFVASGAFSFLVLFFLSTQFPKQQPSLMLQSSMYFNSQGMPIKSPLLTDYPWSPRWEHSQMAER 525
            KL  +P ++ +L     + +P +  G C+ +Y+P +   L  +V   +     RR +I A    FG  + E D+  + K    +    F FLV   L   FP+ QP+L  QS  +F + G  + S    +YP+SPRW+ ++MA+R
Sbjct:  218 KLYLSPRIEHALGGSSALHIPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQ-LYSQAQKNYPYSPRWDGNEMAKR 361          
The following BLAST results are available for this feature:
BLAST of FC929542 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
BRE_DANRE8.622e-1331.72BRCA1-A complex subunit BRE OS=Danio rerio GN=bre ... [more]
BRE_XENTR4.279e-1230.34BRCA1-A complex subunit BRE OS=Xenopus tropicalis ... [more]
BRE_BRAFL7.299e-1228.67BRCA1-A complex subunit BRE OS=Branchiostoma flori... [more]
BRE_CHICK2.124e-1130.34BRCA1-A complex subunit BRE OS=Gallus gallus GN=BR... [more]
BRE_RAT4.731e-1130.34BRCA1-A complex subunit BRE OS=Rattus norvegicus G... [more]
BRE_SAGOE6.179e-1130.34BRCA1-A complex subunit BRE OS=Saguinus oedipus GN... [more]
BRE_PONAB6.179e-1130.34BRCA1-A complex subunit BRE OS=Pongo abelii GN=BRE... [more]
BRE_MOUSE6.179e-1130.34BRCA1-A complex subunit BRE OS=Mus musculus GN=Bre... [more]
BRE_MESAU6.179e-1130.34BRCA1-A complex subunit BRE OS=Mesocricetus auratu... [more]
BRE_HUMAN6.179e-1130.34BRCA1-A complex subunit BRE OS=Homo sapiens GN=BRE... [more]

Pages

back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH2DA03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2DA03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929542 ID=FC929542|Name=FC929542|organism=Citrus clementina|type=EST|length=798bp
GTGGGGTGCCCCTGGAGACATCCACAGAAAATATCCTTGCAGGTCATATA
TCCTGTTAATAGAAAGTATGTTTCTGCTCCTTCAGCACCTCATCTTAAAT
TAATGTCAACACCTGCGTTGAAGTCACTGTTTTCTGTTGATGATGTCAAA
CTTCCTCCATGGTTGGACGGAATGTGTATGGCTGAATACCTTCCCCATCT
AGAAGAAACCCTTGAGAGACAGGTCTCAGAGGCAGTTTCATTAATCGAAG
TTAGAAGACGCTTTATTGAAGCATTAGCTCCTCTATTTGGAAGACCGATA
GAGACTGATTCGGTTTTTTACAGAAAGTCTATGTTTTTTGTTGCCTCTGG
TGCTTTCTCATTCTTGGTGCTATTTTTCCTTTCAACTCAATTTCCAAAGC
AGCAGCCATCTCTCATGCTTCAAAGTTCCATGTATTTCAACTCTCAAGGC
ATGCCGATCAAATCACCCCTTCTGACAGATTATCCTTGGAGTCCAAGATG
GGAACATTCACAAATGGCTGAGAGAACATTTGAATTTTTGGTTGATGAAT
CTGTAAACTTTAAAAAGTACTGCAACGAAGCCCAACTTCAACAGAACCAA
CACTAGTGCATTGTCATGGCAGAATTAGCCTTTCATTTGTTTTAGCCCAT
AGTACCCATTCAAAGTTGTGTAATGTGTGGAACCTGTATTCTCGAATTCT
TTTCCTTGACATTTGTATAAGCTTTTGTCTCGGTGTTGGTATAATTTTCA
TTAGCCTTTGGTGTTGTATTTGTTCATAAAGAAATGAAGCAACTCAAT
back to top