FC929569

Overview
NameFC929569
Unique NameFC929569
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length900
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9278 contig Ccv1_Contig9278:3..887. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS3_ARATH (Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=2)

HSP 1 Score: 362.844 bits (930), Expect = 1.465e-99
Identity = 177/202 (87.62%), Postives = 194/202 (96.04%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 649
            HL++SGKRGI+ EI+LALRFFIYQYGLVYHL +T+ TK+FLVYGVSWLVIFL+LFVMKTVSVGRR+FSA+FQL+FRLIKGLIF+TFI+I+V LI L HMT++DIIVCILAFMPTGWGMLLIAQA KPV+HRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGG RKDRSSRNKE
Sbjct: 1763 HLRYSGKRGIVVEILLALRFFIYQYGLVYHLTITEKTKNFLVYGVSWLVIFLILFVMKTVSVGRRRFSASFQLMFRLIKGLIFMTFIAIIVILITLAHMTIQDIIVCILAFMPTGWGMLLIAQACKPVVHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGHRKDRSSRNKE 1964          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS1_ARATH (Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2)

HSP 1 Score: 315.079 bits (806), Expect = 3.502e-85
Identity = 152/203 (74.88%), Postives = 176/203 (86.70%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTK-HTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 649
            HL+HSG RGI  EI LALRFFI+QYGLVYHL   K   +SF VYG SW VI  +L ++K + VGRR+FS NFQL+FR+IKGL+FLTF++IL+T +ALP +T++D+ +C+LAFMPTGWGMLLIAQA KP+I + G W SVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSS+NKE
Sbjct: 1748 HLRHSGVRGITLEIFLALRFFIFQYGLVYHLSTFKGKNQSFWVYGASWFVILFILLIVKGLGVGRRRFSTNFQLLFRIIKGLVFLTFVAILITFLALPLITIKDLFICMLAFMPTGWGMLLIAQACKPLIQQLGIWSSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1950          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS2_ARATH (Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=2)

HSP 1 Score: 310.071 bits (793), Expect = 1.127e-83
Identity = 150/203 (73.89%), Postives = 174/203 (85.71%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKH-TKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 649
            HL+HSGKRGII EIVLALRFFI+QYGLVY L   K   +S  +YG SW VI  +L ++K + VGR++FS NFQL+FR+IKG +FLTF+ +L+T +AL  +T +DI +C+LAFMPTGWGMLLIAQA KP+I R GFW SVRTLARGYEI+MGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSS+NKE
Sbjct: 1749 HLRHSGKRGIILEIVLALRFFIFQYGLVYQLSTFKQENQSLWIYGASWFVILFILLIVKGLGVGRQRFSTNFQLLFRIIKGFVFLTFLGLLITFLALRFLTPKDIFLCMLAFMPTGWGMLLIAQACKPLIQRLGFWSSVRTLARGYEILMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNKE 1951          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS7_ARATH (Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=2 SV=2)

HSP 1 Score: 243.432 bits (620), Expect = 1.295e-63
Identity = 111/201 (55.22%), Postives = 151/201 (75.12%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNK 646
            HL+H+  RG + EI+LALRF +YQYG+VYHL + +   +FLVYG+SW ++  VL V+K VS+GRRKF  +FQ++FR++K L+FL F+S++  L  +  +T+ D+   ILAF+PTGW +LLI QAL+ V    GFW SV+ L R YE +MGL++FTP+A L+WFPFVSEFQTR+LFNQAFSRGLQIS IL G++   +   K
Sbjct: 1733 HLKHTNLRGRVLEILLALRFLLYQYGIVYHLNIARRHTTFLVYGLSWAILLSVLLVLKMVSMGRRKFGTDFQVMFRILKALLFLGFLSVMTVLFVVCGLTISDLFASILAFLPTGWAILLIGQALRSVFKGLGFWDSVKELGRAYEYIMGLVIFTPIAVLSWFPFVSEFQTRLLFNQAFSRGLQISMILAGKKDKETPSTK 1933          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS4_ARATH (Callose synthase 4 OS=Arabidopsis thaliana GN=CALS4 PE=2 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 2.209e-63
Identity = 118/203 (58.13%), Postives = 152/203 (74.88%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFL-VYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNKE 649
            HLQHSGK GI+ EI  ALRFFI+QYGLVY L   K+  S L V+G SWL+I ++L  +  +   RR+    FQL+FR+IK  +FL F++I +TL+    +  +D+ +C+LA +PTGWG+LLIAQ+ KP+I + G W  V TLA  Y++VMG LLF P+AF+AWFPF+SEFQTRMLFNQAFSRGL ISRIL GQRK RSS+NK+
Sbjct: 1669 HLQHSGKWGIVVEIFFALRFFIFQYGLVYQLSAFKNKYSSLWVFGASWLLILILLLTVTVLDYARRRLGTEFQLLFRIIKVSLFLAFMAIFITLMTCRLILPQDVFLCMLALIPTGWGLLLIAQSCKPLIQQPGIWSWVMTLAWVYDLVMGSLLFIPIAFMAWFPFISEFQTRMLFNQAFSRGLHISRILSGQRKHRSSKNKD 1871          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS6_ARATH (Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2)

HSP 1 Score: 234.958 bits (598), Expect = 4.606e-61
Identity = 110/201 (54.73%), Postives = 150/201 (74.63%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSRNK 646
            HL+H+  RG I EI LALRFFIYQYG+VY L +++ +KSFLVYG+SW+V+   L V+K VS+GRR+F  +FQL+FR++K L+FL F+S++  L  +  +T+ D+   +LAF+PTGW +LLI Q L+  I   G W SV+ L R YE +MGL++F P+A L+WFP VSEFQ R+LFNQAFSRGLQIS IL G++   +S +K
Sbjct: 1721 HLKHTSIRGRILEITLALRFFIYQYGIVYQLNISQRSKSFLVYGLSWVVLLTSLLVLKMVSMGRRRFGTDFQLMFRILKALLFLGFLSVMTILFVVFKLTLTDLSASVLAFLPTGWAILLIGQVLRSPIKALGVWDSVKELGRAYENIMGLVIFAPIAVLSWFPIVSEFQARLLFNQAFSRGLQISMILAGRKDKATSSHK 1921          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS5_ARATH (Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.134e-59
Identity = 113/201 (56.22%), Postives = 149/201 (74.13%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTK-----SFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDR 631
            HL HSG  G   EI L+LR+FIYQYG+VY L +TK ++     S +VYG+SWLVI  V+ V+K VS+GR+KFSA+FQL+FRL+K  +F+  + I+  L     +TV DI+  +LAF+PTGW +L I+Q  +P++   G WGSV+ LARGYE +MG+++F PV  LAWFPFVSEFQTR+LFNQAFSRGLQI RIL G +K +
Sbjct: 1723 HLLHSGFFGKFWEIFLSLRYFIYQYGIVYQLNLTKESRMGKQHSIIVYGLSWLVIVAVMIVLKIVSMGRKKFSADFQLMFRLLKLFLFIGSVVIVGMLFHFLKLTVGDIMQSLLAFLPTGWALLQISQVARPLMKTVGMWGSVKALARGYEYIMGVVIFMPVTVLAWFPFVSEFQTRLLFNQAFSRGLQIQRILAGGKKQK 1923          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS8_ARATH (Putative callose synthase 8 OS=Arabidopsis thaliana GN=CALS8 PE=3 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 3.535e-53
Identity = 96/196 (48.98%), Postives = 138/196 (70.41%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDR 631
            HL+ SG      EI+L+LRFF+YQYGLVYHL +T+   + +VY +SW+VI    F +K V +GR+ FS    LVFR  K  +F++ ++I++TL  + H++V+D++V  LAF+PTGWG++LIAQA++P I     W   + LAR Y+  MG++LF P+A LAW P +S FQTR LFN+AF+R LQI  IL G++K+R
Sbjct: 1781 HLRGSGVGARCLEIILSLRFFVYQYGLVYHLDITQSNTNIIVYALSWVVILATFFTVKAVDLGRQLFSTRKHLVFRFFKVFVFVSILTIIITLANICHLSVKDLLVSCLAFLPTGWGLILIAQAVRPKIEGTSLWEFTQVLARAYDYGMGVVLFAPMAILAWLPIISAFQTRFLFNEAFNRRLQIQPILAGKKKNR 1976          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALS9_ARATH (Callose synthase 9 OS=Arabidopsis thaliana GN=CALS9 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.778e-50
Identity = 99/183 (54.10%), Postives = 130/183 (71.04%), Query Frame = 2
Query:   68 GIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVIHRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGG 616
            G I E +L+LRFFI+QYG+VY LK+     SF VYG SW V F ++ V+  V    +K S NFQL+ R I+GL  L  ++ ++  + L  ++V DI  C+LAF+PTGWG+L IA A KPV+ R G W S+R+LAR Y+ +MG+L+F PVA  +WFPFVS FQTRM+FNQAFSRGL+IS IL G
Sbjct: 1743 GRIMETILSLRFFIFQYGIVYKLKLQGSDTSFAVYGWSW-VAFAMIIVLFKVFTFSQKISVNFQLLLRFIQGLSLLMALAGIIVAVVLTPLSVTDIFACVLAFIPTGWGILSIACAWKPVLKRMGMWKSIRSLARLYDALMGMLIFLPVALCSWFPFVSTFQTRMMFNQAFSRGLEISLILAG 1924          
BLAST of FC929569 vs. ExPASy Swiss-Prot
Match: CALSC_ARATH (Callose synthase 12 OS=Arabidopsis thaliana GN=CALS12 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.657e-43
Identity = 83/194 (42.78%), Postives = 128/194 (65.98%), Query Frame = 2
Query:   44 HLQHSGKRGIIAEIVLALRFFIYQYGLVYHLKMTKHTKSFLVYGVSWLVIFLVLFVMKTVSVGRRKFSANFQLVFRLIKGLIFLTFISILVTLIALPHMTVRDIIVCILAFMPTGWGMLLIAQALKPVI-HRAGFWGSVRTLARGYEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQR 622
            HL+++GK G+  EI+L LRFF +QYG+VY LK+   + S  VY  SW+ IF +  +   +   R K+SA   + +RL++ L+ +  I ++V L+   H +  DI   +LAF+PTGWG+LLIAQ  +  + +   FW +V ++AR Y+I+ G+L+  PVAFL+W P     QTR+LFN+AFSRGL+I +I+ G++
Sbjct: 1582 HLRNTGKAGLFVEIILVLRFFFFQYGIVYQLKIANGSTSLFVYLFSWIYIFAIFVLFLVIQYARDKYSAKAHIRYRLVQFLLIVLAILVIVALLEFTHFSFIDIFTSLLAFIPTGWGILLIAQTQRKWLKNYTIFWNAVVSVARMYDILFGILIMVPVAFLSWMPGFQSMQTRILFNEAFSRGLRIMQIVTGKK 1775          
The following BLAST results are available for this feature:
BLAST of FC929569 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
CALS3_ARATH1.465e-9987.62Callose synthase 3 OS=Arabidopsis thaliana GN=CALS... [more]
CALS1_ARATH3.502e-8574.88Callose synthase 1 OS=Arabidopsis thaliana GN=CALS... [more]
CALS2_ARATH1.127e-8373.89Callose synthase 2 OS=Arabidopsis thaliana GN=CALS... [more]
CALS7_ARATH1.295e-6355.22Callose synthase 7 OS=Arabidopsis thaliana GN=CALS... [more]
CALS4_ARATH2.209e-6358.13Callose synthase 4 OS=Arabidopsis thaliana GN=CALS... [more]
CALS6_ARATH4.606e-6154.73Putative callose synthase 6 OS=Arabidopsis thalian... [more]
CALS5_ARATH1.134e-5956.22Callose synthase 5 OS=Arabidopsis thaliana GN=CALS... [more]
CALS8_ARATH3.535e-5348.98Putative callose synthase 8 OS=Arabidopsis thalian... [more]
CALS9_ARATH4.778e-5054.10Callose synthase 9 OS=Arabidopsis thaliana GN=CALS... [more]
CALSC_ARATH5.657e-4342.78Callose synthase 12 OS=Arabidopsis thaliana GN=CAL... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2DB09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2DB09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929569 ID=FC929569|Name=FC929569|organism=Citrus clementina|type=EST|length=900bp
ACCTGAGAAAAGTTGGGAATCATGGTGGGAGGAAGAACAGGAGCATCTCC
AGCACTCTGGAAAGCGTGGTATCATAGCTGAGATAGTGTTAGCTTTAAGG
TTCTTTATCTATCAGTATGGACTCGTGTACCATTTGAAAATGACAAAGCA
CACTAAAAGTTTTCTGGTCTACGGTGTATCATGGCTGGTGATCTTTCTTG
TATTGTTTGTGATGAAGACTGTATCTGTTGGGCGGCGAAAGTTCAGTGCA
AATTTCCAACTCGTGTTCCGACTGATAAAGGGATTGATATTTTTGACTTT
CATCTCCATCCTGGTCACTTTGATTGCACTTCCACACATGACAGTGCGCG
ACATCATTGTGTGTATTCTCGCATTCATGCCCACTGGTTGGGGAATGCTT
TTGATTGCACAAGCTTTGAAGCCTGTTATTCACCGAGCTGGATTCTGGGG
ATCAGTTAGGACACTTGCTCGTGGCTACGAGATTGTTATGGGTTTGCTTC
TGTTCACCCCAGTTGCGTTCCTTGCTTGGTTTCCTTTTGTGTCAGAATTC
CAGACTCGTATGCTCTTCAACCAAGCATTCAGCAGAGGTCTACAGATCTC
TCGTATTCTTGGCGGGCAGCGGAAGGATCGTTCCTCTCGTAACAAGGAGT
AAAATGAGTGATAGCGAGAGCAGAATCTGTGGTAATTTGTTAATCACTCT
CGCATGTTTAAAGAGAGTTGTCCATAATTTATATTTGTATCCTCTGCGGT
TGTTGTAATCATGGATGACGTCTGGGGGCTGCATTTTTGGTAATTAATTT
GATTGTAAGTCCTGGCAGCCCATAGCTGTCATATTGATTGTATCAAAATT
ATGATTAGTAATTTTTATAATCTATTATCTTATTGAAATAAAAAAAAAAA
back to top