FC929582

Overview
NameFC929582
Unique NameFC929582
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length601
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10079 contig Ccv1_Contig10079:20..620. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX_VERFO (Glutaredoxin OS=Vernicia fordii PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 8.174e-43
Identity = 82/102 (80.39%), Postives = 90/102 (88.24%), Query Frame = 2
Query:   77 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAV 382
            MA+ KAQE VSSNSVVVFSKTFCP+C SVK+L  QLG  FK IELD ESDGSD+Q+ALAEWTGQ+TVPNVFIGGKHIGGCD TT +H EGKL+PLLTEAGAV
Sbjct:    1 MAMIKAQELVSSNSVVVFSKTFCPYCTSVKQLLNQLGAQFKVIELDSESDGSDLQNALAEWTGQRTVPNVFIGGKHIGGCDKTTGMHQEGKLIPLLTEAGAV 102          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX_SOLLC (Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.394e-42
Identity = 81/106 (76.42%), Postives = 94/106 (88.68%), Query Frame = 2
Query:   77 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAVAKTA 394
            M+L KA+E VS N V VFSKT+CPFCVSVK+L  +LG TFKA+ELD E DGS+IQ+ALAEWTGQ+TVPNVFIG KHIGGCD+TTALH EGKL+PLLTEAGA+AKT+
Sbjct:    1 MSLAKAKEIVSGNPVAVFSKTYCPFCVSVKDLLSKLGATFKAVELDSEKDGSEIQAALAEWTGQRTVPNVFIGRKHIGGCDATTALHREGKLLPLLTEAGAIAKTS 106          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GRXC6_ORYSJ (Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 4.057e-42
Identity = 82/106 (77.36%), Postives = 95/106 (89.62%), Query Frame = 2
Query:   77 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAVAKTA 394
            MAL KA+ETV+S  VVV+SK++CPFCV VK+LF+QLG TFKAIELD ESDGS++QSALAEWTGQ+TVPNVFI GKHIGGCD T AL+ EGKLVPLLTEAGA+A +A
Sbjct:    1 MALAKAKETVASAPVVVYSKSYCPFCVRVKKLFEQLGATFKAIELDGESDGSELQSALAEWTGQRTVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGAIASSA 106          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GRXC2_ARATH (Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.485e-41
Identity = 82/107 (76.64%), Postives = 93/107 (86.92%), Query Frame = 2
Query:   77 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAVA-KTA 394
            MA+ KA+E V+S SVVVFSKT+CP+CV VKEL QQLG  FKA+ELD ESDGS IQS LAEWTGQ+TVPNVFIGG HIGGCD+T+ LH +GKLVPLLTEAGA+A KTA
Sbjct:    1 MAMQKAKEIVNSESVVVFSKTYCPYCVRVKELLQQLGAKFKAVELDTESDGSQIQSGLAEWTGQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGAIAGKTA 107          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX_RICCO (Glutaredoxin OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.704e-40
Identity = 77/102 (75.49%), Postives = 90/102 (88.24%), Query Frame = 2
Query:   77 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAV 382
            MA+ K +E VSSN+VVVFSKT+CP+C SVK+L  QLG  +K +ELD ESDGS+IQ+ALAEWTGQ+TVPNVFIGGKHIGGCDSTTA H +G+LVPLLTEAGAV
Sbjct:    1 MAMTKTKELVSSNAVVVFSKTYCPYCTSVKKLLDQLGAKYKVVELDTESDGSEIQTALAEWTGQRTVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAGAV 102          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GRXC4_ORYSJ (Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 7.410e-36
Identity = 71/112 (63.39%), Postives = 89/112 (79.46%), Query Frame = 2
Query:   50 RIKDKEDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAVA 385
            ++++     MAL KA+E V+S+ VVVFSKT+CPFC  VK L  +L  ++KA+ELD ESDGS++QSALA+WTGQ+TVP VFI GKHIGGCD T A+H  G LVPLLTEAGA+A
Sbjct:   18 QLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLAELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAGAIA 129          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GRXC1_ARATH (Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 6.936e-34
Identity = 69/112 (61.61%), Postives = 86/112 (76.79%), Query Frame = 2
Query:   62 KEDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAGAVAKTAA 397
            KE+ E+ + KA+E VS+  VVVFSKT+C +C  VK+L  QLG TFK +ELD+ SDG +IQSAL+EWTGQ TVPNVFI G HIGGCD     + +GKLVPLLTEAGA+A  ++
Sbjct:   12 KEEMEVVVNKAKEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEMSDGGEIQSALSEWTGQTTVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGAIADNSS 123          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX_DICDI (Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.549e-25
Identity = 52/98 (53.06%), Postives = 74/98 (75.51%), Query Frame = 2
Query:   83 LPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLLTEAG 376
            + K +  + ++ +++FSKT CP+C+SVK+LF++L V    +ELD ESDGS++QSA  + +G +TVP VFI  K IGGCD+TT LH +GKL+PLL EAG
Sbjct:    1 MDKVKALIKAHKLIIFSKTTCPYCISVKDLFKKLKVVPFVVELDLESDGSELQSAAGQISGVRTVPQVFINEKFIGGCDATTKLHSQGKLIPLLQEAG 98          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX2_MOUSE (Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.500e-20
Identity = 45/100 (45.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:   65 EDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLL 364
            + T   + + QET+S+N VV+FSKT C +C   K++F  + V +KA+ELD    G+  Q AL + TG++TVP +F+ G+ IGG   T  LH EGKL+PL+
Sbjct:   44 KSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLV 143          
BLAST of FC929582 vs. ExPASy Swiss-Prot
Match: GLRX2_BOVIN (Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.559e-20
Identity = 45/90 (50.00%), Postives = 59/90 (65.56%), Query Frame = 2
Query:   95 QETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHGEGKLVPLL 364
            QET+S+N VV+FSKT C +C   K LF  + V +K +ELD    GS  Q AL + TG++TVP +F+ G  IGG   T  LH EGKL+PL+
Sbjct:   55 QETISNNCVVIFSKTSCSYCTMAKNLFHDMNVNYKVVELDMLEYGSQFQDALHKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLV 144          
The following BLAST results are available for this feature:
BLAST of FC929582 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
GLRX_VERFO8.174e-4380.39Glutaredoxin OS=Vernicia fordii PE=3 SV=1[more]
GLRX_SOLLC1.394e-4276.42Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1[more]
GRXC6_ORYSJ4.057e-4277.36Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN... [more]
GRXC2_ARATH4.485e-4176.64Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 P... [more]
GLRX_RICCO1.704e-4075.49Glutaredoxin OS=Ricinus communis PE=3 SV=1[more]
GRXC4_ORYSJ7.410e-3663.39Glutaredoxin-C4, chloroplastic OS=Oryza sativa sub... [more]
GRXC1_ARATH6.936e-3461.61Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 P... [more]
GLRX_DICDI1.549e-2553.06Glutaredoxin OS=Dictyostelium discoideum GN=grxA P... [more]
GLRX2_MOUSE1.500e-2045.00Glutaredoxin-2, mitochondrial OS=Mus musculus GN=G... [more]
GLRX2_BOVIN2.559e-2050.00Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLR... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1AE12RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1AE12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929582 ID=FC929582|Name=FC929582|organism=Citrus clementina|type=EST|length=601bp
TTTGTAAAGCCAAAGAGGATTTGAAGCTTATTTAGGGTTTGTGAGATTTC
GAATCAAAGACAAAGAAGACACAGAAATGGCTTTGCCCAAGGCCCAGGAA
ACCGTTTCCTCCAATTCCGTCGTCGTTTTCAGCAAAACGTTTTGTCCGTT
CTGCGTGAGTGTCAAAGAGCTGTTTCAGCAACTCGGAGTCACTTTCAAGG
CCATTGAACTGGACAAAGAAAGTGATGGAAGTGACATTCAATCAGCTCTA
GCTGAGTGGACTGGACAGAAAACTGTTCCAAATGTCTTCATTGGAGGGAA
ACACATTGGTGGCTGCGATTCAACTACTGCACTGCACGGGGAAGGGAAGC
TGGTTCCTCTGCTCACTGAAGCTGGAGCTGTTGCCAAGACAGCTGCCTAA
TGGATGGCTATTGTCTGCCTGTTAATTCTAGTAATAAATAAAGAATGTGT
TGGTAGTGCTTAATCTGTCTGAATTAAACATGAAATTATGCTTATTTGAG
TAATTTCCAATGCACTTTTTTGTTCAGTTTCTGTTTTATGTTGAAATCTG
TATGAATTTTATCAGATTTTCCATCTACTAAAAAAAAAAAAAAAAAAAAA
A
back to top