FC929584

Overview
NameFC929584
Unique NameFC929584
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length767
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9525 contig Ccv1_Contig9525:24..790. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBC16_ARATH (Probable ubiquitin carrier protein E2 16 OS=Arabidopsis thaliana GN=UBC16 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.554e-85
Identity = 145/161 (90.06%), Postives = 154/161 (95.65%), Query Frame = 1
Query:   34 MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV 516
            M+SS APSRK LSKIA+NRLQKELVEWQ+NPP GFKHKVTDNLQRWIIEV GAPGTLYAN+T++LQVDFPEHYPME+PQVIFL PAPLHPHIYSNGHICLDILYDSWSPAMTVSS+CISILSMLSSST KQRP DNDRYVKNC+NGRSPKETRWWFHDDKV
Sbjct:    1 MSSSGAPSRKTLSKIATNRLQKELVEWQMNPPTGFKHKVTDNLQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQVIFLHPAPLHPHIYSNGHICLDILYDSWSPAMTVSSICISILSMLSSSTEKQRPTDNDRYVKNCKNGRSPKETRWWFHDDKV 161          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBC18_ARATH (Probable ubiquitin carrier protein E2 18 OS=Arabidopsis thaliana GN=UBC18 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 6.062e-85
Identity = 144/161 (89.44%), Postives = 153/161 (95.03%), Query Frame = 1
Query:   34 MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV 516
            MTSSS+PSRKALSKIA NRLQKEL EWQVNPP GFKH+VTDNLQ+W+IEV GAPGTLYANET+ LQV+FP+HYPMEAPQVIF+PPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSS  KQRP DNDRYVKNC+NGRSPKETRWWFHDDKV
Sbjct:    1 MTSSSSPSRKALSKIACNRLQKELSEWQVNPPTGFKHRVTDNLQKWVIEVTGAPGTLYANETYNLQVEFPQHYPMEAPQVIFVPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSPEKQRPTDNDRYVKNCKNGRSPKETRWWFHDDKV 161          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBC15_ARATH (Ubiquitin-conjugating enzyme 15 OS=Arabidopsis thaliana GN=UBC15 PE=2 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 2.547e-83
Identity = 141/161 (87.58%), Postives = 152/161 (94.41%), Query Frame = 1
Query:   34 MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV 516
            MTSSSAPSRKALSKIA NRLQKEL EWQ+NPP GF+HKVTDNLQ+W I+V GAPGTLYANET++LQV+FPEHYPMEAPQV+F+ PAP HPHIYSNGHICLDILYDSWSPAMTV+SVCISILSMLSSS  KQRPADNDRYVKNC+NGRSPKETRWWFHDDKV
Sbjct:    1 MTSSSAPSRKALSKIACNRLQKELSEWQLNPPTGFRHKVTDNLQKWTIDVTGAPGTLYANETYQLQVEFPEHYPMEAPQVVFVSPAPSHPHIYSNGHICLDILYDSWSPAMTVNSVCISILSMLSSSPAKQRPADNDRYVKNCKNGRSPKETRWWFHDDKV 161          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBC17_ARATH (Probable ubiquitin carrier protein E2 17 OS=Arabidopsis thaliana GN=UBC17 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 4.653e-77
Identity = 129/161 (80.12%), Postives = 149/161 (92.55%), Query Frame = 1
Query:   34 MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV 516
            MTSSS  +RK L+KIA+NRLQKE +EWQ NPP+GFKH+V+DNLQRWIIEV+G PGTLYANET++LQV+FPEHYPMEAPQVIF  PAPLHPHIYSNGHICLD+LYDSWSPAM +SS+C+SILSMLSSS+VKQ+P DND Y+KNC++GRSPKETRW FHDDKV
Sbjct:    1 MTSSSESTRKGLTKIATNRLQKEFMEWQTNPPSGFKHRVSDNLQRWIIEVHGVPGTLYANETYQLQVEFPEHYPMEAPQVIFQHPAPLHPHIYSNGHICLDVLYDSWSPAMRLSSICLSILSMLSSSSVKQKPKDNDHYLKNCKHGRSPKETRWRFHDDKV 161          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBE2W_DICDI (Probable ubiquitin-conjugating enzyme E2 W OS=Dictyostelium discoideum GN=ube2w PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 8.856e-44
Identity = 82/145 (56.55%), Postives = 104/145 (71.72%), Query Frame = 1
Query:   82 SNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDDKV 516
            + RLQKEL++ + NPP        DNL +W+I V+G  G++Y  E F+LQ  F   YP+++P+VIF+   P+HPHIYSNGHICL ILYD+WSPA+TVSSVC+SILSMLS  T K RP D+ +YV    N +SPKE RW FHDD V
Sbjct:    6 AKRLQKELLDLKTNPPPCISITEGDNLDKWVIAVDGTEGSIYQGEHFKLQFKFSSGYPLDSPEVIFIGTPPIHPHIYSNGHICLSILYDNWSPALTVSSVCLSILSMLSGCTEKIRPTDDSKYVSRVLN-KSPKEVRWMFHDDTV 149          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBE2W_MOUSE (Probable ubiquitin-conjugating enzyme E2 W OS=Mus musculus GN=Ube2w PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.013e-39
Identity = 75/145 (51.72%), Postives = 103/145 (71.03%), Query Frame = 1
Query:   88 RLQKELVEWQVNPPAGF---KHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPP-APLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDD 510
            RLQKEL+  Q +PP G    +  V +++ +WI+++ GAPGTLY  E F+L   F   YP ++PQV+F     P+HPH+YSNGHICL IL + WSPA++V SVC+SI+SMLSS   K+RP DN  YV+ C   ++PK+T+WW+HDD
Sbjct:    7 RLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTC--NKNPKKTKWWYHDD 149          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBE2W_HUMAN (Probable ubiquitin-conjugating enzyme E2 W OS=Homo sapiens GN=UBE2W PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.323e-39
Identity = 75/145 (51.72%), Postives = 103/145 (71.03%), Query Frame = 1
Query:   88 RLQKELVEWQVNPPAGF---KHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPP-APLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDD 510
            RLQKEL+  Q +PP G    +  V +++ +WI+++ GAPGTLY  E F+L   F   YP ++PQV+F     P+HPH+YSNGHICL IL + WSPA++V SVC+SI+SMLSS   K+RP DN  YV+ C   ++PK+T+WW+HDD
Sbjct:    7 RLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTC--NKNPKKTKWWYHDD 149          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UBE2W_DANRE (Probable ubiquitin-conjugating enzyme E2 W OS=Danio rerio GN=ube2w PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 3.850e-39
Identity = 76/145 (52.41%), Postives = 100/145 (68.97%), Query Frame = 1
Query:   88 RLQKELVEWQVNPPAGF---KHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPP-APLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSMLSSSTVKQRPADNDRYVKNCRNGRSPKETRWWFHDD 510
            RLQKEL+  Q +PPAG    +  V + +  W I++ GA GT+Y  E F+L   F   YP E+PQV+F     P+HPH+YSNGHICL IL + WSPA++V SVC+SI+SMLSS   K+RP DN  YVK C   ++PK+T+WW+HDD
Sbjct:    7 RLQKELLALQNDPPAGMTLNERSVQNTITEWFIDMEGAQGTVYEGEKFQLLFKFSSRYPFESPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVKTC--NKNPKKTKWWYHDD 149          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UB2D1_MOUSE (Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus GN=Ube2d1 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.172e-17
Identity = 50/111 (45.05%), Postives = 64/111 (57.66%), Query Frame = 1
Query:   76 IASNRLQKELVEWQVNPPAGFKH-KVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSML 405
            +A  R+QKEL + Q +PPA      V D+L  W   + G P + Y    F L V FP  YP + P++ F      HP+I SNG ICLDIL   WSPA+TVS V +SI S+L
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKI-YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLL 110          
BLAST of FC929584 vs. ExPASy Swiss-Prot
Match: UB2D1_HUMAN (Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens GN=UBE2D1 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.172e-17
Identity = 50/111 (45.05%), Postives = 64/111 (57.66%), Query Frame = 1
Query:   76 IASNRLQKELVEWQVNPPAGFKH-KVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVIFLPPAPLHPHIYSNGHICLDILYDSWSPAMTVSSVCISILSML 405
            +A  R+QKEL + Q +PPA      V D+L  W   + G P + Y    F L V FP  YP + P++ F      HP+I SNG ICLDIL   WSPA+TVS V +SI S+L
Sbjct:    1 MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKI-YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLL 110          
The following BLAST results are available for this feature:
BLAST of FC929584 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
UBC16_ARATH3.554e-8590.06Probable ubiquitin carrier protein E2 16 OS=Arabid... [more]
UBC18_ARATH6.062e-8589.44Probable ubiquitin carrier protein E2 18 OS=Arabid... [more]
UBC15_ARATH2.547e-8387.58Ubiquitin-conjugating enzyme 15 OS=Arabidopsis tha... [more]
UBC17_ARATH4.653e-7780.12Probable ubiquitin carrier protein E2 17 OS=Arabid... [more]
UBE2W_DICDI8.856e-4456.55Probable ubiquitin-conjugating enzyme E2 W OS=Dict... [more]
UBE2W_MOUSE1.013e-3951.72Probable ubiquitin-conjugating enzyme E2 W OS=Mus ... [more]
UBE2W_HUMAN1.323e-3951.72Probable ubiquitin-conjugating enzyme E2 W OS=Homo... [more]
UBE2W_DANRE3.850e-3952.41Probable ubiquitin-conjugating enzyme E2 W OS=Dani... [more]
UB2D1_MOUSE3.172e-1745.05Ubiquitin-conjugating enzyme E2 D1 OS=Mus musculus... [more]
UB2D1_HUMAN3.172e-1745.05Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2DC03RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2DC03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929584 ID=FC929584|Name=FC929584|organism=Citrus clementina|type=EST|length=767bp
TCCAGACGGTGCCGTTCTCTTCTCGTGGAAGCCATGACCAGTTCATCTGC
TCCTTCACGCAAGGCTTTAAGCAAGATCGCAAGTAATAGACTGCAAAAAG
AGCTTGTGGAGTGGCAAGTCAATCCTCCAGCGGGATTCAAACACAAAGTC
ACTGATAATCTGCAAAGGTGGATAATCGAAGTCAACGGAGCGCCGGGGAC
GCTCTATGCGAACGAAACGTTTGAGCTTCAAGTGGATTTCCCTGAGCATT
ACCCTATGGAGGCACCTCAAGTGATTTTTCTCCCTCCAGCTCCTCTGCAT
CCCCACATTTATAGCAATGGACATATCTGTTTAGATATTCTTTATGATTC
CTGGTCCCCGGCAATGACTGTTAGTTCTGTATGTATCAGCATTCTCTCCA
TGTTGTCAAGCTCAACTGTGAAGCAACGGCCCGCCGATAACGACCGTTAT
GTGAAGAACTGTAGGAATGGGAGATCTCCAAAGGAGACAAGATGGTGGTT
CCATGATGATAAAGTGTAATGATAGAAGAAGTATCAATTAGCTGTAACCT
GTGTATAAAATGGAGGGTTTTGGGAAAGATTCGTGGAAGGCATCTGGAAA
GGGGGCTGCCATTGCTATGCCTATAAAAACCTGTCCACTGTTTTTTATGT
TTTCACTTGCTCTGTACTCGGGATGATTTTATATTTTGGTTGTACTGCCC
TCCCGTAACAGGTTTCATAATTTCAATGATATCCTAATTATCAATAGGAA
CAAAAAAAAAAAAAAAA
back to top