FC929815

Overview
NameFC929815
Unique NameFC929815
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length792
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 1.781e-111
Identity = 200/249 (80.32%), Postives = 222/249 (89.16%), Query Frame = 1
Query:   46 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            MA KSKILFIGGTGYIGKFIVEASAKAGH TFVLVRESTLS+P+K++L+D FK  GV  V GD+ +HESLVKAIKQVDVVISTVGH LL DQVK+IAAIKEAGN+KRFFPSEFGNDVDRVHAVEPAK+AF TKA+IRR VEAEGIP+TYVA+ FFA Y LPNL+QPGA  PP DKVVILG GN KAV+NKE+DIGTYTI AVDDP+TLNKILYIKPP NI + N+LVSLWE+K GK L+R+YVPEEQVL
Sbjct:    1 MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRVHAVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKEEDIGTYTINAVDDPKTLNKILYIKPPHNIITLNELVSLWEKKTGKNLERLYVPEEQVL 249          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.239e-96
Identity = 173/250 (69.20%), Postives = 203/250 (81.20%), Query Frame = 1
Query:   43 VMASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            V++ KSKIL IGGTGYIGK++VE SAK+GHPTF L+RESTL +P KS+L+D FK  GV L+ GD+ N ESL+KAIKQVDVVISTVG     DQV II AIKEAGNIKRF PSEFG DVD   A+EPA S FA K +IRR +EAEGIPYTYV  N+FA +FLPNL Q  A  PPRDKVVI GDGNPKA+Y KE+DI TYTI+AVDDPRTLNK L+++PP NI SFN++VSLWE KIGKTL+++Y+ EE +L
Sbjct:    2 VVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFLPSEFGFDVDHARAIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRDKVVIFGDGNPKAIYVKEEDIATYTIEAVDDPRTLNKTLHMRPPANILSFNEIVSLWEDKIGKTLEKLYLSEEDIL 251          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 8.881e-95
Identity = 175/248 (70.56%), Postives = 202/248 (81.45%), Query Frame = 1
Query:   55 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQ--PGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            KSKIL IGGTGYIGKF+VEASAKAGH TF LVRE+TLSDP K + +  FK LGV ++ GD+ +HESLVKAIKQVDVVISTVG   + DQ KII+AIKEAGN+KRF PSEFG DVDR  AVEPAKSAFA K +IRR +EAEGIPYTY  +  F  Y+LP L Q  PG T+PPRDKV ILGDGN KAV NKE+DI  YTIKAVDDPRTLNKILYIKP  N  S N++V+LWE+KIGK+L++ ++PEEQ+L
Sbjct:    5 KSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDRTSAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPSNNTLSMNEIVTLWEKKIGKSLEKTHLPEEQLL 252          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.428e-78
Identity = 144/248 (58.06%), Postives = 178/248 (71.77%), Query Frame = 1
Query:   49 ASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            + KSKIL +GGTGY+G+ +V ASA+ GHPT  LVR++  SDP+K+ LL  F+  GV L+ GD+ +  SLV A+K  DVVIS +G   + DQ +++ AIKEAGN+KRFFPSEFG DVDR   VEPAKS    K  IRRA EA GIPYTY  + FFA + LP + Q  A  PP DK V+LGDG+ KAV+ +E DI TYT+ A DDPR  NK+LYIKPP N  S N+L+SLWE+K GKT +R YVPEE VL
Sbjct:    3 SEKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVKRFFPSEFGLDVDRTGIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPADKAVVLGDGDTKAVFVEEGDIATYTVLAADDPRAENKVLYIKPPANTLSHNELLSLWEKKTGKTFRREYVPEEAVL 250          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.288e-77
Identity = 147/260 (56.54%), Postives = 193/260 (74.23%), Query Frame = 1
Query:   46 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRES----------TLSDP-SKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            MA+++KIL +G TG IG+ IV AS KAG+PT+ LVR++          T ++P +K +L+D+++ LGV L+ GD+ +HE+LVKAIKQVD+VI   G  L+ DQVKII AIKEAGN+K+FFPSEFG DVDR  AVEP +  F  KA IRR +EAEG+PYTY+  + F  YFL NL+Q   T PPRDKVVILGDGN K  Y  E D+GT+TI+A +DP TLNK ++I+ P N  + N++++LWE+KIGKTL++ YV EEQVL
Sbjct:    1 MATENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDRHEAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRDKVVILGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPENYLTQNEVIALWEKKIGKTLEKTYVSEEQVL 260          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.749e-77
Identity = 149/260 (57.31%), Postives = 189/260 (72.69%), Query Frame = 1
Query:   46 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRES-----------TLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            MAS+++IL +G TG IG+ +V AS KAG+PT+ L+R++             +  SK +LL  FK  GV L+ GD+ +HE+LVKAIKQVD VI T G  L+ DQVKII AIKEAGN+KRFFPSEFG DVDR  AV+P +  F  KA IRR VEAEG+PYTY+  + F  YFL NL+Q  AT PPRDKV+ILGDGN K  Y  E D+GTYTI+A +DPRTLNK ++I+ P N  + N++VSLWE+KIGKTL++ Y+ EE+VL
Sbjct:    1 MASQNRILVLGPTGAIGRHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVKRFFPSEFGLDVDRHDAVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRDKVIILGDGNVKGAYVTEADVGTYTIRAANDPRTLNKAVHIRLPHNYLTSNEVVSLWEKKIGKTLEKSYISEEKVL 260          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 5.413e-76
Identity = 144/260 (55.38%), Postives = 188/260 (72.31%), Query Frame = 1
Query:   46 MASKSKILFIGGTGYIGKFIVEASAKAGHPTFVLVREST-----------LSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            MA+++KIL +G TG IG+ IV AS KAG+PT+ LVR+++            +  +K +LL +++  GV L+ GD+ +HE+LV AIKQVD VI   G  L+ DQVK+I AIKEAGN+KRFFPSEFG DVDR  AVEP +  F  KA IRR VE+EG+PYTY+  + F  YFL NL+Q  AT PPRDKVVILGDGN +  Y  E D+GTYTI+A +DP TLNK ++I+ P N  + N++++LWE+KIGKTL++ YV EEQVL
Sbjct:    1 MATENKILILGATGAIGRHIVWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVKRFFPSEFGLDVDRHDAVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRDKVVILGDGNVRGAYVTEADVGTYTIRAANDPNTLNKAVHIRLPNNYLTANEVIALWEKKIGKTLEKTYVSEEQVL 260          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 8.108e-64
Identity = 128/253 (50.59%), Postives = 168/253 (66.40%), Query Frame = 1
Query:   55 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVG------HTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRV-HAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            KSK+L +GGTGY+G+ IV+AS + GH TF+L R     D  K Q+L  FKK G  LV     +H+SLV A+K VDVVI T+       H LL  Q+K++ AIK+AGNIKRF PSEFG D   + HA+EP +  F  K  +R+A+E   IP+TY+++N FA YF  NLSQ     PPRDKV++ GDGN K VY  EDD+ TYTIK +DDPRTLNK +Y++PP NI +  +L+  WE  IGK L++  + E+  L
Sbjct:    3 KSKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLL-TQLKLVEAIKDAGNIKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRDKVLLYGDGNVKPVYMDEDDVATYTIKTIDDPRTLNKTVYLRPPENILTHKELIEKWEELIGKQLEKNSISEKDFL 254          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.294e-61
Identity = 122/247 (49.39%), Postives = 164/247 (66.40%), Query Frame = 1
Query:   55 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRE-STLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            K KIL +G TGY+GK++V+AS   GHPT+  V      SD SK QLL  F+ LGV +  G++  H+ LV   K+VD+VIST+      +Q+K+I AIKEAGNIKRF PSEFGN+VDRV A+   ++    K KIRRA EA GIP+T+V++N   AYF+  L  P   +   ++V I G G+ KAV N E+D+  YTIKA DDPR  N++L IKPP NI S  DLVS WE+  G TL+  ++ E++++
Sbjct:    5 KGKILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVDRVRALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKS---EQVTIYGSGDAKAVLNYEEDVAAYTIKAADDPRAANRVLIIKPPKNIVSQLDLVSSWEKTTGSTLKMTHISEQEII 248          
BLAST of FC929815 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 5.438e-60
Identity = 117/246 (47.56%), Postives = 165/246 (67.07%), Query Frame = 1
Query:   55 KSKILFIGGTGYIGKFIVEASAKAGHPTFVLVRESTLSDPSKSQLLDHFKKLGVNLVIGDVLNHESLVKAIKQVDVVISTVGHTLLGDQVKIIAAIKEAGNIKRFFPSEFGNDVDRVHAVEPAKSAFATKAKIRRAVEAEGIPYTYVASNFFAAYFLPNLSQPGATAPPRDKVVILGDGNPKAVYNKEDDIGTYTIKAVDDPRTLNKILYIKPPGNIYSFNDLVSLWERKIGKTLQRVYVPEEQVL 792
            KSKIL  GGTGYIG  +V+ S K GHPT+V  R ++    SK+ LLD F+ LG  +V G++  HE LV+ +K+VDVVIS +    + DQ KI+ AIK AGNIKRF PS+FG + DR++A+ P ++    K  IRRA+E   IPYTYV++N FA+YF+  L +P     P+D++ + G G  K   N E DIG YTIK   DPR LN+++  +P  NI +  +L+S WE+KIGK  ++++VPEE+++
Sbjct:    7 KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNS----SKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRP---YDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIV 245          
The following BLAST results are available for this feature:
BLAST of FC929815 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU1.781e-11180.32Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_TOBAC1.239e-9669.20Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFRH_ARATH8.881e-9570.56Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFRH_MAIZE4.428e-7858.06Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFR_MEDSA1.288e-7756.54Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_CICAR3.749e-7757.31Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFR_PEA5.413e-7655.38Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_LUPAL8.108e-6450.59Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY1.294e-6149.39Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA5.438e-6047.56Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AE10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AE10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929815 ID=FC929815; Name=FC929815; organism=Citrus clementina; type=EST; length=792bp
AAAAAAGGAATTAATCCCCGAAATTGAACTGAATAATTCTCGGTAATGGC
GTCGAAAAGCAAGATTCTATTCATCGGCGGTACAGGGTACATCGGCAAAT
TCATCGTCGAAGCGAGCGCGAAAGCCGGCCACCCGACGTTCGTGCTCGTG
AGAGAATCCACACTCTCCGATCCTTCCAAATCTCAGCTCCTCGATCACTT
CAAAAAACTCGGCGTCAATCTCGTCATCGGAGATGTGTTGAATCACGAGA
GCTTGGTGAAGGCGATAAAACAAGTGGACGTGGTGATATCAACGGTCGGT
CACACTTTATTAGGTGATCAGGTCAAGATTATTGCGGCCATTAAAGAAGC
TGGTAACATTAAGAGATTCTTCCCTTCAGAATTTGGGAATGATGTTGATC
GAGTCCATGCCGTTGAGCCAGCAAAATCAGCATTTGCCACAAAGGCAAAA
ATCCGCCGAGCCGTTGAGGCTGAAGGGATTCCGTATACTTATGTAGCGTC
GAATTTCTTTGCTGCTTACTTCCTTCCCAATTTGTCGCAGCCCGGGGCCA
CTGCCCCACCTAGGGATAAAGTTGTCATCTTAGGCGATGGAAATCCAAAA
GCTGTTTATAACAAGGAAGATGATATTGGAACCTATACTATCAAAGCGGT
TGATGATCCCAGAACCTTGAACAAAATCCTTTACATTAAACCCCCTGGTA
ATATTTACTCATTCAATGATCTTGTGTCCTTGTGGGAGAGAAAGATTGGC
AAAACCCTCCAAAGGGTGTACGTTCCGGAAGAACAAGTCCTA
back to top