FC929833

Overview
NameFC929833
Unique NameFC929833
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length764
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929833 vs. ExPASy Swiss-Prot
Match: UFOG_PETHY (Anthocyanidin 3-O-glucosyltransferase OS=Petunia hybrida GN=RT PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.391e-73
Identity = 138/227 (60.79%), Postives = 168/227 (74.01%), Query Frame = 1
Query:   94 DQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPMADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFTHYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPARKLN----NSLADLMKSPDGFPATSITSLDEFVARDYLYVYTKFNGGPSVYERGIQGVDGCDVLAIKTCNEMEGPYLDF 762
            D LHVVMFP+FAFGHISPFVQL+NKLS +GVKVSFF+A GN  R+KS LN  P   I+PL +PHV+GLPPG +ST+E+TP  AELLK ALDLMQPQIKTLLS LKPHFV FDF   WLP +    LGIKTV +SV  A+S A+L  PAR L      SL D+ K P GFP TS+TS+  F ARD+LYV+  F+ GP++Y+R   G+ GC  +  KTC++MEGPY+ +
Sbjct:   10 DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPKMANG-LGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFEARDFLYVFKSFHNGPTLYDRIQSGLRGCSAILAKTCSQMEGPYIKY 235          
BLAST of FC929833 vs. ExPASy Swiss-Prot
Match: FLRT_CITMA (Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase OS=Citrus maxima GN=C12RT1 PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.050e-12
Identity = 58/232 (25.00%), Postives = 103/232 (44.40%), Query Frame = 1
Query:   79 ESAEADQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSL--NLTPMADIIPLQIPHV-DGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFTHYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPARKLNNSLADLMKSPDGFPATSITSLDEFVARDYLYVYTKFNGGPSVYERGIQGVD-GCDVLAIKTCNEMEGPYLDF 762
            ++   D+  ++M PW A GHI+P ++L+ KLS     + F S P N+     ++  N +    +I LQ+P+    LP    +T  + PH+   L  A +  +P    +L  LKP  V +D     +      Q  I  + F   SA++ ++L      L+N +   +K P        +   +  +++  Y       G    +R ++  +  C  + IKT  E+E  YLD+
Sbjct:    2 DTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFSSSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMYDLFQP-MAAEAAYQYDIAAILFLPLSAVACSFL------LHNIVNPSLKYP-----FFESDYQDRESKNINYFLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDY 221          
The following BLAST results are available for this feature:
BLAST of FC929833 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
UFOG_PETHY1.391e-7360.79Anthocyanidin 3-O-glucosyltransferase OS=Petunia h... [more]
FLRT_CITMA3.050e-1225.00Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltran... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AG06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AG06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929833 ID=FC929833; Name=FC929833; organism=Citrus clementina; type=EST; length=764bp
GGCAAGAGAGACACAGAGACCATGCACGCCTCTTCGAACATGCACGCCCC
TTCGAACCAACACCACAAAATGGGAACTGAATCAGCTGAAGCTGATCAGC
TTCACGTGGTGATGTTCCCATGGTTTGCTTTTGGTCACATAAGCCCCTTT
GTACAACTTTCCAACAAGCTCTCACTTCATGGAGTCAAGGTCTCTTTCTT
TTCGGCTCCTGGTAACATTCCCCGCATCAAATCATCGCTCAATTTAACTC
CCATGGCCGACATTATCCCTCTTCAAATCCCACACGTCGATGGCCTCCCT
CCTGGTCTTGATAGCACCTCAGAGATGACACCTCACATGGCTGAGCTCCT
AAAGCAAGCCTTGGACCTCATGCAACCACAAATCAAAACTTTGTTGTCAC
AGCTCAAACCCCATTTTGTGTTCTTTGATTTTACCCATTACTGGTTGCCG
GGTCTTGTTGGTTCTCAACTTGGCATCAAAACAGTTAACTTCTCTGTTTT
CTCTGCCATTTCACAAGCCTATCTCGTGGTTCCCGCCAGGAAACTCAACA
ACAGTTTAGCAGATCTAATGAAATCTCCCGATGGGTTCCCTGCAACTTCC
ATTACCTCGCTCGATGAATTTGTGGCTCGAGATTACTTGTATGTTTATAC
AAAGTTCAATGGCGGCCCGAGTGTTTATGAGAGAGGGATTCAGGGCGTTG
ATGGCTGCGATGTTCTTGCCATCAAGACATGTAATGAAATGGAGGGTCCT
TACCTGGATTTCGT
back to top