FC929844

Overview
NameFC929844
Unique NameFC929844
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929844 vs. ExPASy Swiss-Prot
Match: MEX1_ARATH (Maltose excess protein 1, chloroplastic OS=Arabidopsis thaliana GN=MEX1 PE=1 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 1.351e-67
Identity = 126/237 (53.16%), Postives = 156/237 (65.82%), Query Frame = 3
Query:   15 SAGDSDVPHPFHQESANFRSNKAFEEWNSLTAKFSGAANIPFMLLQLPQIIXXXXXXXXXXXXXXXXVPWXXXXXXXXXXXXXXSYFIKKREKEAIVVQTLGVVSTYVVISQLAVGEAMPMPHFIAISVVVATGLVLNFLNYFNMLNAGLWRFWEDVITVGGLTALPQVIWSTFVPTIPNSILPGTIAFXXXXXXXXXXXXXKLSKQGVKFVRAISGWTATLLFMWMPVFTMWTNFL 725
            S  DSD PH   Q +      K ++EW+S TAKFSG ANIPF++LQLPQII                VPW              SYF KKREKEA VVQTLGVVST++V++QL + EAMP+ +F+A S VV  GL++N L YF  L+  +W+ WEDVIT+GGL+ LPQ++WSTFVP +PNSILPGT AF             KLS++GV+FV ++SGWTATL+FMWMPV  MWTNFL
Sbjct:   76 SDSDSDFPHENQQGNPGLGKFKEYQEWDSWTAKFSGGANIPFLMLQLPQIILNTQNLLAGNNTALSAVPWLGMLTGLLGNLSLLSYFAKKREKEAAVVQTLGVVSTHIVLAQLTMAEAMPIQYFVATSAVVTIGLIVNCLYYFGKLSKTVWQLWEDVITIGGLSVLPQIMWSTFVPLVPNSILPGTTAFGIAVAAIIMARTGKLSEKGVRFVGSLSGWTATLMFMWMPVSQMWTNFL 312          
BLAST of FC929844 vs. ExPASy Swiss-Prot
Match: MEX1_ORYSJ (Maltose excess protein 1-like, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0602400 PE=2 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 2.157e-65
Identity = 122/216 (56.48%), Postives = 146/216 (67.59%), Query Frame = 3
Query:   78 KAFEEWNSLTAKFSGAANIPFMLLQLPQIIXXXXXXXXXXXXXXXXVPWXXXXXXXXXXXXXXSYFIKKREKEAIVVQTLGVVSTYVVISQLAVGEAMPMPHFIAISVVVATGLVLNFLNYFNMLNAGLWRFWEDVITVGGLTALPQVIWSTFVPTIPNSILPGTIAFXXXXXXXXXXXXXKLSKQGVKFVRAISGWTATLLFMWMPVFTMWTNFL 725
            K ++EW+SLTAKF+GAAN+PF+LLQLPQII                VPW              SYF KK+E  A++VQTLGV+STYVVI+QLA+ E+MP+P F+A S VVA GL+LNFLNYF  L   LW  WED IT+GGL  LPQV+WSTFVP IPNS+LPG I+              KLSK G+ FV ++SGWTATLLFMWMPV  MWTN+L
Sbjct:   81 KKYQEWDSLTAKFAGAANVPFLLLQLPQIILNARNLLAGNKTALFAVPWLGMLTGLLGNLSLLSYFAKKKETGAVIVQTLGVISTYVVIAQLAMAESMPLPQFVATSAVVAAGLLLNFLNYFGWLPGTLWLLWEDFITIGGLAVLPQVMWSTFVPFIPNSLLPGIISGSLAATAVVMARMGKLSKGGINFVGSLSGWTATLLFMWMPVAQMWTNYL 296          
The following BLAST results are available for this feature:
BLAST of FC929844 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
MEX1_ARATH1.351e-6753.16Maltose excess protein 1, chloroplastic OS=Arabido... [more]
MEX1_ORYSJ2.157e-6556.48Maltose excess protein 1-like, chloroplastic OS=Or... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34001A06EF PostHarvC1 Citrus clementina cDNA clone C34001A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929844 ID=FC929844|Name=FC929844|organism=Citrus clementina|type=EST|length=727bp
GACTCAGTCCCGTTTCTGCCGGTGACTCGGATGTGCCTCACCCTTTTCAC
CAGGAATCGGCAAATTTTAGGAGCAATAAAGCCTTTGAGGAATGGAATTC
GTTAACAGCCAAGTTCTCTGGAGCAGCAAATATCCCCTTTATGTTACTGC
AACTACCTCAGATAATCCTAAATGCCCGCAATCTGTTAGCAGGAAATAAG
GCTGCCCTTTTGGCAGTTCCCTGGCTGGGAATGCTGACTGGTTTACTTGG
GAATCTCTCACTCCTGTCATATTTTATAAAGAAGAGGGAGAAAGAGGCAA
TAGTTGTTCAAACCTTGGGTGTTGTTTCCACATATGTGGTAATTTCACAG
CTTGCTGTGGGAGAAGCAATGCCTATGCCTCACTTCATAGCCATCTCAGT
AGTTGTGGCGACTGGTCTTGTTTTAAACTTCCTAAATTACTTTAACATGC
TTAATGCTGGACTTTGGCGATTCTGGGAAGATGTTATAACAGTTGGCGGA
CTGACGGCTCTTCCCCAAGTTATATGGTCCACGTTTGTACCCACTATACC
AAATAGTATCTTGCCTGGGACTATAGCTTTTGTCGTAGGTGTGGCTGCTG
TTGTTATGGNCAGAATGGGCAAACTTTCAAAGCAAGGAGTTAAGTTTGTT
CGAGCAATTTCTGGATGGACTGCTACACTTCTGTTCATGTGGATGCCAGT
TTTCACAATGTGGACAAATTTTCTAAA
back to top