FC929857

Overview
NameFC929857
Unique NameFC929857
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.055e-48
Identity = 104/227 (45.81%), Postives = 149/227 (65.64%), Query Frame = 2
Query:   50 LFISCILWLVFTLVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVVDPSE---REFKDTVWGIMEEAGKPNLSEHFPLLK 721
            L I   L L + L+  + +     G+ K LPPGP   P+IGNL  LG  PH+SLAKLAKIHGPIMSL+LGQ+TT+V+SS + A+ +LK+ D +F  R VP+AV +    H   S+ +L V   W+ LR++ + +IF++  L+A Q LR KK+++L+AY  +     + +  G+AAF TSLNLLSNTIFS D+ DP E   +EF++ +  IM ++ K NL + FP+LK
Sbjct:    4 LIIVSTLLLSYILIWVLGV-----GKPKNLPPGPTRLPIIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRNVPDAVRAY--NHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCRKAALSNENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIMVDSAKTNLVDVFPVLK 223          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.325e-42
Identity = 92/235 (39.15%), Postives = 144/235 (61.28%), Query Frame = 2
Query:   44 MDLFISCILWLVFT------LVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPL-WKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDV---VDPSEREFKDTVWGIMEEAGKPNLSEHFPLL 718
            MD+     L+L+F       L+   A S  S GR   LPPGP   P+IGN+ ++G  PH S A LAKI+GPIMSL+ G + +VV++SP  A+ +L+ HD     RK  +++      H E S++WLP S   W+ LRKL    +F+ Q+ +A + LR KK+++L+++++E+    +A+D  +A++ T LN++SN +FS+D+         EF+DTV G ME AGKP+ + +FP +
Sbjct:    1 MDIISGQALFLLFCFISSCFLISTTARSRRSSGRAATLPPGPPRLPIIGNIHQVGKNPHSSFADLAKIYGPIMSLKFGCLNSVVITSPEAAREVLRTHDQILSGRKSNDSIRCF--GHEEVSVIWLPPSSARWRMLRKLSVTLMFSPQRTEATKALRMKKVQELVSFMNESSERKEAVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQDTVIGAMEAAGKPDAANYFPFM 233          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.635e-39
Identity = 86/235 (36.60%), Postives = 140/235 (59.57%), Query Frame = 2
Query:   32 VSSKMDLFISCILWLVFTLVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPL-WKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDV----VDPSEREFKDTVWGIMEEAGKPNLSEHFPLLK 721
            +S +  L + C +   F +        ISRG    LPPGP   P+IGN+  +G  PH+S A+L+K +GP+MSL+LG + TVV++SP  A+ +L+ HD     R    AV S+   H + SLVWLP S   W+ LR+L    + + Q+++A + LR  K+K+L++++ E+    +++D  + AF T+LN++SN +FS+D+       S    +DTV  +M+ AG P+ + +FP L+
Sbjct:    4 ISGQALLLLFCFILSCFLIFTTTRSGRISRGATA-LPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARSPTNAVRSI--NHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFISESSDREESVDISRVAFITTLNIISNILFSVDLGSYNAKASINGVQDTVISVMDAAGTPDAANYFPFLR 235          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 7.665e-39
Identity = 86/224 (38.39%), Postives = 136/224 (60.71%), Query Frame = 2
Query:   74 LVFTLVCAMALSSISRGRRKQ----LPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVV----DPSEREFKDTVWGIMEEAGKPNLSEHFPLLK 721
            L F L       + ++ RR      LPPGP   P++GN+ +LG  PH+SLA  +K +GPIMSL+LG++T VV+SSP  AK  L+ HD     R   +A+ +    H + S+VW+P S  W+ L+K    ++ + Q LDA Q LR +K+++L++ V+E    G+AID  +A+F TS N++SN +FS+D+     + S  EF +TV  + + AG PN+ ++F  ++
Sbjct:   13 LYFLLTLFFFFFATAKTRRSSSTGTLPPGPPILPLVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSARTFNDALRAFD--HHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVNEFRERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEFHNTVVHLTDIAGIPNVGDYFQYMR 234          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.475e-38
Identity = 86/235 (36.60%), Postives = 140/235 (59.57%), Query Frame = 2
Query:   44 MDLFISCILWLVFTLVCAMAL----SSISRGRRKQLP--PGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWL-PVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVVDPSERE---FKDTVWGIMEEAGKPNLSEHFPLL 718
            MD+     L+ +F  V +  +    ++  R  RK +P  PGP   P+IGN+  +G  PH S A L+K +GPIMSL+ G + TVVV+SP  A+ +L+ +D     R    ++ S+   H + S+VWL P S  W+ LRKL    +F+ Q+++A + LR  K+K+L++++ E+    +A+D  +A F T+LN++SN +FS+D+ +    +   F+DTV G+ME  G P+ +  FP L
Sbjct:    1 MDIIFEQALFPLFCFVLSFFIIFFTTTRPRSSRKVVPSPPGPPRLPIIGNIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTNSIRSI--NHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTVIGVMEAVGNPDAANFFPFL 233          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 5.685e-34
Identity = 80/228 (35.09%), Postives = 129/228 (56.58%), Query Frame = 2
Query:   50 LFISCILWLVFTLVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFS---IDVVDPS--EREFKDTVWGIMEEAGKPNLSEHFPLL 718
            + IS IL+L+F                K LPPGP+P+P++GNLL+LG KPH   A+LA+ +G I +L++G  T VV S+ S A  ILK HD     R V ++       H E S+VW   +  WKNLRK+C   +FT + +++   +R KK ++++ Y+ +  + G+ +   +  F T +N+  N IFS    ++ DP+    EFK+ +W ++E     N +++FP+L
Sbjct:   10 VIISSILYLLF-----------GGSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSF--RVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGDPNSGSSEFKEYLWRMLELGNSTNPADYFPML 222          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.425e-34
Identity = 78/228 (34.21%), Postives = 127/228 (55.70%), Query Frame = 2
Query:   50 LFISCILWLVFTLVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVVD-----PSEREFKDTVWGIMEEAGKPNLSEHFPLL 718
            + IS IL+L+F                K LPPGP+P+P++GNLL+LG KPH   A+LA+ +G I +L++G  T VV S+ S A  ILK HD     R V ++       H E S+VW   +  WKNLRK+C   +FT + +++   +R KK ++++ Y+ +  + G+ +   +  F T +N+  N IFS ++ +         EFK+ +W ++E     N +++FP+L
Sbjct:   11 VIISSILYLLF-----------GSSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSF--RVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGXPNSGSSEFKEYLWRMLELGNSTNPADYFPML 223          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.191e-29
Identity = 79/230 (34.35%), Postives = 126/230 (54.78%), Query Frame = 2
Query:   56 ISCILW-LVFTLVCAMALSSISRGRRK-QLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDV-------VDPSEREFKDTVWGIMEEAGKPNLSEHFPLL 718
            +S IL+ ++F+ +    L S  R R    LPPGP+P+P+IGNL+ LG KPH+S A +A+ +GP+M L++G V  VV +S S+A   LK HD++F  R        +   + +  LV+ P  P W+ LRK+C++H+F+++ LD  + +R+ ++K L   +    +  K +  GQ     + N L+  +    V       VDP   EFK  V  +M  AG  N+ +  P L
Sbjct:    4 LSLILYTVIFSFLLQFILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQD--LVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQ--KPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVAGVFNIGDFIPQL 229          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.499e-26
Identity = 64/202 (31.68%), Postives = 113/202 (55.94%), Query Frame = 2
Query:  134 QLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDE---NCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVVD---PSEREFKDTVWGIMEEAGKPNLSEHFPLLK 721
            + PPGP   P+ GN+ ELG +P+K +A L + +GP++ L+LG   T+VV +   ++ + K HD SF +R +P+  ++  + + + SL   P  P W+  R++C + +F  +K+   + +RRK + ++L ++++   +   G  I+  +  F  S N+L N I S D+ D       EF   +  I E +G  N+S+ FP LK
Sbjct:   34 KFPPGPPGLPIFGNMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPD--VNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMKRINEWSGIANVSDIFPFLK 233          
BLAST of FC929857 vs. ExPASy Swiss-Prot
Match: C71BC_ARATH (Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.442e-26
Identity = 63/221 (28.51%), Postives = 119/221 (53.85%), Query Frame = 2
Query:   68 LWLV---FTLVCAMALSSISRGRRKQLPPGPRPYPVIGNLLELGGKPHKSLAKLAKIHGPIMSLRLGQVTTVVVSSPSMAKAILKEHDSSFRDRKVPEAVLSLPNRHPEFSLVWLPVSPLWKNLRKLCNMHIFTSQKLDANQDLRRKKIKDLLAYVDENCRMGKAIDFGQAAFNTSLNLLSNTIFSIDVVDPS-EREFKDTVWGIMEEAGKPNLSEHFPLL 718
            LW +   F    +M +  I R  +K LPPGP   P+IGNL +LG KPH+S+ KL++ +GP+MSL+ G V+TVV S+P   K +LK  D     R  P         +    L + P S  W+ +RK+  + ++T++++ + Q  R++++  L+ ++ +   + K ++  +     S +++    F I++     E  +++ + G +E  G    +++FP++
Sbjct:    3 LWYIIVAFVFFSSMIIVRIIRKTKKNLPPGPPRLPIIGNLHQLGSKPHRSMFKLSETYGPLMSLKFGSVSTVVASTPETVKEVLKTFDVECCSR--PNMTYPARVTYNLKDLCFSPYSKYWREVRKMTVVELYTAKRVQSFQHTRKEEVAALVDFIKQAASLEKPVNLNKKLMKLSGSVICRVAFGINLQGSKLENTYEEVIQGTVELVGSFAAADYFPVV 221          
The following BLAST results are available for this feature:
BLAST of FC929857 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 125
Match NameE-valueIdentityDescription
C76B1_HELTU4.055e-4845.817-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C4_ARATH3.325e-4239.15Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C1_ARATH2.635e-3936.60Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76C3_ARATH7.665e-3938.39Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
C76C2_ARATH8.475e-3836.60Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C80B1_ESCCA5.685e-3435.09(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
C80B2_ESCCA7.425e-3434.21(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
F3PH_PETHY7.191e-2934.35Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C76A2_SOLME1.499e-2631.68Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
C71BC_ARATH7.442e-2628.51Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001B09EF PostHarvC1 Citrus clementina cDNA clone C34001B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929857 ID=FC929857|Name=FC929857|organism=Citrus clementina|type=EST|length=721bp
GATTGAGGGTTCGAAATAAAGAGAACTTAAAGTAAGCTCAAAGATGGATT
TGTTCATTAGCTGTATACTATGGCTTGTATTCACATTGGTTTGCGCGATG
GCTTTAAGTTCCATTTCTAGAGGAAGACGCAAACAGCTTCCACCGGGACC
GAGGCCATATCCGGTGATCGGAAACCTCCTGGAGCTGGGTGGTAAACCTC
ACAAGTCACTGGCCAAGCTTGCCAAGATTCATGGCCCCATAATGAGTCTA
AGACTTGGCCAGGTGACCACAGTAGTGGTTTCTTCTCCAAGCATGGCTAA
AGCTATACTTAAAGAACATGATTCATCATTCAGAGATCGAAAGGTCCCTG
AAGCAGTCTTGTCCCTGCCTAACCGGCACCCTGAATTCAGCTTGGTCTGG
CTGCCAGTCTCACCACTATGGAAAAATCTTCGAAAACTATGCAACATGCA
TATTTTCACTAGTCAGAAACTCGATGCCAATCAAGACCTCCGACGCAAGA
AAATCAAAGACCTTCTTGCTTATGTTGATGAAAATTGCCGTATGGGCAAA
GCAATAGATTTTGGCCAAGCTGCTTTTAATACTTCACTTAATTTGTTATC
CAACACGATTTTTTCTATTGATGTCGTTGATCCCAGTGAGCGAGAGTTTA
AGGATACAGTTTGGGGTATCATGGAAGAAGCAGGAAAGCCTAACTTGTCC
GAACATTTTCCTCTACTAAAA
back to top