FC929863

Overview
NameFC929863
Unique NameFC929863
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length706
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13920 contig Ccv1_Contig13920:76..781. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 2.960e-88
Identity = 159/231 (68.83%), Postives = 191/231 (82.68%), Query Frame = 3
Query:   21 FRSPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAY--NALGEKEKRFEIFKENLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMHLGARF---GAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYK 698
            F  PTMA+  L +  VSSA+DMSI+SYD+ H   ++  R++ EVM+++EAWLVKHGKA   N+L EK++RFEIFK+NLRF+DEHN +N +Y++GL RFADLTN+EYRS +LGA+    G +RTSL      RY  RVG+ LP+S+DWRKKGAVAEVKDQG CGSCWAFSTI AVEGIN+IVTG LI+LSEQELVDCDTSYNEGCNGGLMDYAFEFII NGGIDT++DYPYK
Sbjct:    3 FLKPTMAILFLAMVAVSSAVDMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSL------RYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYK 227          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.092e-74
Identity = 140/228 (61.40%), Postives = 172/228 (75.44%), Query Frame = 3
Query:   27 SPTMAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSEN----RTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYK 698
            S  +A   L L    +A DMSIVSY +         R+++E   ++  W  +HGK+YNA+GE+E+R+  F++NLR+IDEHN+       ++++GLNRFADLTNEEYR  +LG R   +R   + K S+RYL    EALP+SVDWR KGAVAE+KDQG CGSCWAFS IAAVEGIN+IVTG LISLSEQELVDCDTSYNEGCNGGLMDYAF+FII+NGGIDTE+DYPYK
Sbjct:    4 SMALAAAALLLLLSLAAADMSIVSYGE---------RSEEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRFADLTNEEYRDTYLGLRNKPRR---ERKVSDRYLAADNEALPESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCDTSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYK 219          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: ACTN_ACTDE (Actinidain OS=Actinidia deliciosa PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.019e-69
Identity = 134/222 (60.36%), Postives = 169/222 (76.13%), Query Frame = 3
Query:   36 MAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSE-NRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYN-EGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            ++M LLF  T+   L +S+        +K+ + RT+DEV AM+E+WL+K+GK+YN+LGE E+RFEIFKE LRFIDEHN++ NR+YKVGLN+FADLT+EE+RS +LG   G+ +T    K SNRY PRVG+ LP  VDWR  GAV ++K QG CG CWAFS IA VEGINKIVTG LISLSEQEL+DC  + N  GCNGG +   F+FII+NGGI+TEE+YPY
Sbjct:    8 VSMSLLFFSTL---LILSLA-----FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKT----KVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPY 217          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 1.169e-68
Identity = 128/229 (55.90%), Postives = 170/229 (74.24%), Query Frame = 3
Query:   36 MAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYN----ALGEKEKRFEIFKENLRFIDEHNSENR--TYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSN-RYLPRV-GEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYK 698
            +++ LL++    ++ D SI++ D         WRTD+EV +++  W  +HGK  N     + +++KRF IFK+NLRFID HN +N+  TYK+GL +F DLTN+EYR ++LGAR    R   K+K  N +Y   V G+ +P++VDWR+KGAV  +KDQG+CGSCWAFST AAVEGINKIVTG LISLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY+
Sbjct:    8 LSLLLLYVVVSLASGDESIIN-DHLQLPSDGKWRTDEEVRSIYLQWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNEDNKNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCWAFSTTAAVEGINKIVTGELISLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYR 235          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: ACTN_ACTCH (Actinidain OS=Actinidia chinensis PE=1 SV=4)

HSP 1 Score: 258.07 bits (658), Expect = 3.402e-68
Identity = 133/222 (59.91%), Postives = 168/222 (75.68%), Query Frame = 3
Query:   36 MAMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSE-NRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYN-EGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            ++M LLF  T+   L +S+        +K+ + RT+DEV AM+E+WL+K+GK+YN+LGE E+RFEIFKE LRFIDEHN++ NR+YKVGLN+FADLT+EE+RS +L    G+ +T    K SNRY PRVG+ LP  VDWR  GAV ++K QG CG CWAFS IA VEGINKIVTG LISLSEQEL+DC  + N  GCNGG +   F+FII+NGGI+TEE+YPY
Sbjct:    8 VSMSLLFFSTL---LILSLA-----FNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLRFTSGSNKT----KVSNRYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNGGYITDGFQFIINNGGINTEENYPY 217          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.521e-65
Identity = 122/221 (55.20%), Postives = 166/221 (75.11%), Query Frame = 3
Query:   39 AMFLLFLFTVSSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNS-ENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSY-NEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            A+ +L +  +SS+L ++         +++   R + EV  M+E WLV++ K YN LGEKE+RF+IFK+NL+F+DEHNS  +RT++VGL RFADLTNEE+R+++L  +    + S+K++R   YL + G+ LPD VDWR  GAV  VKDQG+CGSCWAFS + AVEGIN+I TG LISLSEQELVDCD  + N GC+GG+M+YAFEFI+ NGGI+T++DYPY
Sbjct:   12 ALVILSVLLLSSSLGVA---------TETEIERNETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEEFRAIYLRKKMERTKDSVKTER---YLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDRGFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPY 220          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 7.341e-63
Identity = 121/232 (52.16%), Postives = 161/232 (69.40%), Query Frame = 3
Query:   21 FRSPTMAMFLLFLFTVSSAL-------DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            F +P+++ F L +   +SAL       D SIV Y   H + +      D+++ +FE+W+ +H KAY ++ EK  RFE+F+ENL  ID+ N+E  +Y +GLN FADLT+EE++  +LG      + S K + S  +  R    LP SVDWRKKGAVA VKDQG CGSCWAFST+AAVEGIN+I TG+L SLSEQEL+DCDT++N GCNGGLMDYAF++II  GG+  E+DYPY
Sbjct:    3 FSAPSLSKFSLLVAISASALLCCAFARDFSIVGYTPEHLTNT------DKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRNNEINSYWLGLNEFADLTHEEFKGRYLG--LAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCDTTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPY 226          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 2.136e-62
Identity = 117/209 (55.98%), Postives = 152/209 (72.73%), Query Frame = 3
Query:   69 SSALDMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            +S+ D SIV Y            + D+++ +FE W+    KAY  + EK  RFE+FK+NL+ IDE N + ++Y +GLN FADL++EE++ M+LG +    R   + +    +  R  EA+P SVDWRKKGAVAEVK+QGSCGSCWAFST+AAVEGINKIVTG+L +LSEQEL+DCDT+YN GCNGGLMDYAFE+I+ NGG+  EEDYPY
Sbjct:   26 ASSHDYSIVGYSP------EDLESHDKLIELFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDETNKKGKSYWLGLNEFADLSHEEFKKMYLGLKTDIVRRD-EERSYAEFAYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQELIDCDTTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPY 227          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: CPR4_ARATH (Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.084e-61
Identity = 119/234 (50.85%), Postives = 158/234 (67.52%), Query Frame = 3
Query:   21 FRSPTMAMFLLFLFTVS--SALDMSIVSYDKTHESKSSSWRT----DDEVMAMFEAWLVKHGKAYNALGEKEKRFEIFKENLRFIDEHNSENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPYKPL 704
            +    M +FLL L   S  +A+DMS+VS +  H   +   R     D E   MFE+W+VKHGK Y+++ EKE+R  IF++NLRFI   N+EN +Y++GLNRFADL+  EY  +  GA     R  +    SNRY    G+ LP SVDWR +GAV EVKDQG C SCWAFST+ AVEG+NKIVTG L++LSEQ+L++C+   N GC GG ++ A+EFI++NGG+ T+ DYPYK L
Sbjct:    3 YAKSAMLIFLLALVIASCATAMDMSVVSSNDNHHVTAGPGRRQGIFDAEATLMFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENLSYRLGLNRFADLSLHEYGEICHGADPRPPRNHVFMTSSNRYKTSDGDVLPKSVDWRNEGAVTEVKDQGLCRSCWAFSTVGAVEGLNKIVTGELVTLSEQDLINCNKE-NNGCGGGKVETAYEFIMNNGGLGTDNDYPYKAL 235          
BLAST of FC929863 vs. ExPASy Swiss-Prot
Match: CYSP4_BRANA (Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 1.999e-60
Identity = 114/189 (60.32%), Postives = 148/189 (78.31%), Query Frame = 3
Query:  153 MAMFEAWLVKHGKAYN----ALGEKEKRFEIFKENLRFIDEHNSENR--TYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSN-RYLPRVG-EALPDSVDWRKKGAVAEVKDQGSCGSCWAFSTIAAVEGINKIVTGSLISLSEQELVDCDTSYNEGCNGGLMDYAFEFIIDNGGIDTEEDYPY 695
            M+++  W ++HGK+ +     + ++++RF IFK+NLRFID HN  N+  TYK+GL  FA+LTN+EYRS++LGAR    R   K+K  N +Y   V  + +P +VDWR+KGAV  +KDQG+CGSCWAFST AAVEGINKIVTG L+SLSEQELVDCD SYN+GCNGGLMDYAF+FI+ NGG++TE+DYPY
Sbjct:    1 MSIYLRWSLEHGKSNSNSNGIINQQDERFNIFKDNLRFIDLHNENNKNATYKLGLTIFANLTNDEYRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEVPVTVDWRQKGAVNAIKDQGTCGSCWAFSTAAAVEGINKIVTGELVSLSEQELVDCDKSYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPY 189          
The following BLAST results are available for this feature:
BLAST of FC929863 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 156
Match NameE-valueIdentityDescription
RD21A_ARATH2.960e-8868.83Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
ORYA_ORYSJ1.092e-7461.40Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
ACTN_ACTDE4.019e-6960.36Actinidain OS=Actinidia deliciosa PE=1 SV=1[more]
GCP1_ARATH1.169e-6855.90Germination-specific cysteine protease 1 OS=Arabid... [more]
ACTN_ACTCH3.402e-6859.91Actinidain OS=Actinidia chinensis PE=1 SV=4[more]
CPR1_ARATH3.521e-6555.20Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
XCP1_ARATH7.341e-6352.16Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
XCP2_ARATH2.136e-6255.98Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
CPR4_ARATH3.084e-6150.85Probable cysteine proteinase At4g11320 OS=Arabidop... [more]
CYSP4_BRANA1.999e-6060.32Cysteine proteinase COT44 (Fragment) OS=Brassica n... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001C04EF PostHarvC1 Citrus clementina cDNA clone C34001C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929863 ID=FC929863|Name=FC929863|organism=Citrus clementina|type=EST|length=706bp
TTCTCAAAAGATGGGNTTTGTTTAGATCACCAACCATGGCCATGTTTTTA
CTTTTTCTCTTCACTGTTTCATCTGCCTTGGACATGTCGATTGTATCTTA
TGATAAAACCCATGAGTCAAAATCTAGCAGCTGGAGGACCGACGATGAGG
TTATGGCTATGTTCGAGGCCTGGCTCGTGAAGCATGGCAAGGCTTATAAC
GCTTTGGGTGAAAAAGAGAAGAGGTTTGAGATCTTTAAGGAAAATCTTAG
GTTTATTGATGAACATAACTCAGAGAACCGGACCTACAAGGTTGGGTTGA
ACCGGTTTGCTGATTTGACCAACGAGGAGTACCGGTCCATGCATCTGGGT
GCACGCTTTGGTGCTAAAAGGACTTCCTTGAAATCAAAGAGGAGCAACCG
TTATCTGCCACGTGTCGGCGAGGCGTTGCCGGACTCTGTTGATTGGAGGA
AGAAAGGAGCTGTCGCTGAAGTTAAAGATCAAGGAAGCTGTGGGAGTTGC
TGGGCATTTTCAACCATTGCAGCTGTAGAGGGTATAAACAAGATTGTTAC
AGGTAGCCTGATCTCACTATCCGAGCAGGAGTTGGTGGATTGTGATACAT
CATATAATGAAGGATGTAATGGTGGTTTGATGGACTATGCATTCGAGTTC
ATTATTGATAATGGAGGTATTGACACAGAAGAAGATTACCCCTACAAGCC
ATTGAT
back to top