FC929917

Overview
NameFC929917
Unique NameFC929917
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length682
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11341 contig Ccv1_Contig11341:30..711. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929917 vs. ExPASy Swiss-Prot
Match: FB119_ARATH (F-box protein At2g27310 OS=Arabidopsis thaliana GN=At2g27310 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.246e-32
Identity = 82/200 (41.00%), Postives = 110/200 (55.00%), Query Frame = 2
Query:  104 SIWTVHPDIMETHVFKHXXXXXXXXXXXXXXXXXXXXXDETLWTDISNSTWPSTNTPGIRQLISSFPKGTRSFFSDSFTNPDVSITTPSSSPVNLDCPSRLISAVDIFYQQRHVFGKVVETEPLN-----FDSSPFRIDVLDPKDSVPTRIPHPVD--EQMMCEFGERFTLSWILIDPIRRRAMNLSSYKPVIVERRWMS 682
            SI T+H DI++T +                        +E LW ++S  TWPS N P + Q ISSFP G RSFF+DS+  P    T  S      D P+ LISAVD++Y+   ++ KV E E        F SSPFR+D+LDPK+SV TRI +P    E  + +  E   L+WILIDPI++RA N+SS K V   R W++
Sbjct:   11 SISTLHSDIIQTQILTRLDGPTLASTATTSSYLQTLCTEEKLWQELSIDTWPSINDPRVVQAISSFPSGYRSFFADSY--PFTEHTWQSEKH---DPPTGLISAVDLYYRGEIIYSKVQEMETEKGKSGWFLSSPFRVDILDPKESVQTRIRYPGGDYEAWVKDMEESMKLNWILIDPIKKRAANISSRKAVSARRNWLT 205          
The following BLAST results are available for this feature:
BLAST of FC929917 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
FB119_ARATH8.246e-3241.00F-box protein At2g27310 OS=Arabidopsis thaliana GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34001G12EF PostHarvC1 Citrus clementina cDNA clone C34001G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929917 ID=FC929917|Name=FC929917|organism=Citrus clementina|type=EST|length=682bp
GAAGAATCTCGGAGAGCTTTTACATTTCCTCTCACTCATACCCATCCCAT
AAAATAATCGAACGGATATGGATTCTCCGTCGGTGGCCGACACCACCAGC
AGCTCAATCTGGACCGTCCATCCTGATATCATGGAAACTCATGTCTTCAA
ACATTTAGACGCCTCTGCCCTCGCCTCCGCCTCCTGCGCCTCCTCTCAGC
TCTACGCCCTCGCTTCCGACGAAACTCTCTGGACAGACATTAGCAACTCG
ACGTGGCCCTCCACCAACACTCCAGGCATCCGCCAGCTCATCTCGTCGTT
CCCCAAGGGGACCCGCTCCTTCTTCTCCGACTCCTTCACCAACCCCGACG
TCAGCATCACAACCCCTTCCTCCTCTCCGGTCAATCTCGATTGTCCCTCA
CGATTAATCTCAGCCGTTGATATTTTCTACCAGCAACGGCACGTATTCGG
TAAAGTCGTCGAAACTGAGCCATTGAATTTCGATAGCTCTCCGTTCAGGA
TCGACGTACTTGATCCGAAAGATTCGGTGCCCACCCGGATACCTCACCCG
GTGGACGAGCAGATGATGTGCGAATTTGGGGAGCGTTTCACGTTGAGCTG
GATTTTGATAGATCCGATCAGACGGCGGGCGATGAATTTATCGAGTTACA
AGCCGGTGATTGTAGAACGCCGCTGGATGTCT
back to top