FC929918

Overview
NameFC929918
Unique NameFC929918
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length651
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15114 contig Ccv1_Contig15114:12..662. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.228e-100
Identity = 185/190 (97.37%), Postives = 185/190 (97.37%), Query Frame = 3
Query:   81 MAAMTSTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            MAAM STAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN
Sbjct:    1 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 190          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.664e-71
Identity = 132/168 (78.57%), Postives = 148/168 (88.10%), Query Frame = 3
Query:  147 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQSVSPGGGAWLGGQLFS MVVRKPAH+FLDELGI+YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 186          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 4.530e-69
Identity = 136/191 (71.20%), Postives = 158/191 (82.72%), Query Frame = 3
Query:   81 MAAMTSTAFAPSVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            MAA+ ST    S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQSVSPGGGAWLGGQLFSAM+VRKPAH+FLDE+G+ YDEQD YVV+KHAALFTSTIMSKLLARPNVKLFN
Sbjct:    1 MAAIASTL---SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFN 183          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 8.275e-63
Identity = 127/188 (67.55%), Postives = 146/188 (77.66%), Query Frame = 3
Query:  120 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQSVSPGGGAWLGGQLFSAMVVRKPAH+FLDELG+ YDE ++YVVIKHAALFTST+MS LLARPNVKLFN
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFN 189          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.081e-62
Identity = 124/186 (66.67%), Postives = 145/186 (77.96%), Query Frame = 3
Query:  120 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQSVSPGGGAWLGGQLFSAMVVR+PAH+FLDELG+ YDE ++YVV+KHAALFTST+MS+LLARPNVKLFN
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFN 186          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 6.587e-44
Identity = 87/141 (61.70%), Postives = 115/141 (81.56%), Query Frame = 3
Query:  234 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+G+ Y+++ +YVV+KHAALFTST+M++ LA PNVKLFN
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFN 177          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 2.503e-43
Identity = 87/129 (67.44%), Postives = 104/129 (80.62%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE SVSPGGGAWLGGQLFSAM++RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN+KLFN
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFN 172          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 2.119e-42
Identity = 87/131 (66.41%), Postives = 107/131 (81.68%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDE--QDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E SVSPGGGAWLGGQLFSAMV+R+PA +FL+ELG+ Y+E    NYVV+KHA+LFTST+MSK+L+ PNVKLFN
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFN 178          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.614e-42
Identity = 87/129 (67.44%), Postives = 102/129 (79.07%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN KLFN
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFN 176          
BLAST of FC929918 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.052e-41
Identity = 85/158 (53.80%), Postives = 113/158 (71.52%), Query Frame = 3
Query:  189 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFN 650
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E +V+PGGG WLGGQL SAMV RKPA  FLD++G+ Y+++ N+VV+KHAALFTST++SK+LA PNVK+FN
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFN 181          
The following BLAST results are available for this feature:
BLAST of FC929918 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
THI4_CITSI2.228e-10097.37Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.664e-7178.57Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH4.530e-6971.20Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE8.275e-6367.55Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE1.081e-6266.67Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO6.587e-4461.70Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX2.503e-4367.44Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR2.119e-4266.41Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSSH3.614e-4267.44Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_UROFA1.052e-4153.80Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001H01EF PostHarvC1 Citrus clementina cDNA clone C34001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929918 ID=FC929918|Name=FC929918|organism=Citrus clementina|type=EST|length=651bp
TCATCACTGCTGCAAATCAAATTACTTCTCATTATCAAACTTCTAAGCAG
CAGGGGAAGGAGGGGTTAAAAAAAAAAAACATGGCAGCCATGACTTCTAC
AGCTTTCGCTCCTTCAGTTTCGTCCACCACCAATAAGCTCTTTGACTCAT
CCTTTCATGGGGCTCCCATGTCACCTTCTCTTCTACGTCTTCAACCCATC
AAATCTTCTCGTCCCAACAACTTGTCCATTTCTGCTTCTGCTTCTCCTCC
TTATGACTTGAACACTTTCAAGTTTGACCCCATCAAAGAATCCATTGTTT
CTCGTGAAATGACACGCAGGTACATGACGGACATGATCACTTATGCTGAC
ACTGATGTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCTCTCTTGTGCTTA
TGAGCTCAGCAAAAACCCCAACATTCAGATTGCTATTATCGAACAGTCTG
TTAGCCCCGGCGGTGGCGCGTGGCTCGGTGGACAGCTCTTCTCTGCCATG
GTTGTGCGCAAACCAGCCCACATCTTCCTTGACGAGCTTGGCATCGACTA
CGATGAGCAAGACAACTATGTTGTGATCAAGCATGCAGCGCTGTTCACCT
CCACTATAATGAGCAAGCTCCTGGCCCGCCCCAACGTCAAGCTCTTTAAT
G
back to top