FC929920

Overview
NameFC929920
Unique NameFC929920
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length733
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15105 contig Ccv1_Contig15105:49..781. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK3_PETHY (S-adenosylmethionine synthetase 3 OS=Petunia hybrida GN=SAM3 PE=2 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 2.629e-127
Identity = 218/230 (94.78%), Postives = 227/230 (98.70%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTNLVMVFG ITTKANV+YEKIVRDTCRNIGF+SDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+K+PEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIA DLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRDTCRNIGFISDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKQPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAHDLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK_MESCR (S-adenosylmethionine synthetase OS=Mesembryanthemum crystallinum GN=METK PE=2 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.884e-125
Identity = 216/230 (93.91%), Postives = 224/230 (97.39%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            M+TFLFTSESVNEGHPDKLCDQISDA+LDACL QD +SKVACETCTKTNLVMVFG ITTKANV+YEKI RDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 MDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDAESKVACETCTKTNLVMVFGEITTKANVDYEKIARDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 448.358 bits (1152), Expect = 1.884e-125
Identity = 215/230 (93.48%), Postives = 226/230 (98.26%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDPDSKVACETCTKTN+VMVFG ITTKA V+YEKIVRDTCR+IGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTV+ISTQHDETVTND+IAADLKEHVIKPVIP +YLDE+TIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVVISTQHDETVTNDQIAADLKEHVIKPVIPEKYLDERTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK2_PEA (S-adenosylmethionine synthetase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 5.483e-125
Identity = 214/229 (93.45%), Postives = 224/229 (97.82%), Query Frame = 3
Query:   45 ETFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            ETFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTN+VMVFG ITTKANV+YEKIVRDTCRNIGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGHL+KRPE+IGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA LTEVRKNGTCPWLRPDGKTQVTVEYYN+ GAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEFMPLSHVLATKLGASLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 232          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 7.160e-125
Identity = 215/230 (93.48%), Postives = 224/230 (97.39%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACL QDPDSKVACETC+KTN+VMVFG ITTKANV+YEKIVRDTCR IGFVSDDVGLDADNCKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPE+MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.595e-124
Identity = 212/230 (92.17%), Postives = 223/230 (96.96%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDPDSKVACETCTKTN+VMVFG ITTK  ++YEKIVRDTCRNIGF+SDDVGLDAD CKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPE+MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYN+NGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 2.721e-124
Identity = 213/230 (92.61%), Postives = 224/230 (97.39%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACLEQDP+SKVACETCTKTNLVMVFG ITTKA V+YEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHL+KRPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEY N+NGAM+P++VHTVLISTQHDETVTNDEIA DLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNLVMVFGEITTKAIVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYCNDNGAMIPIKVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 4.641e-124
Identity = 214/230 (93.04%), Postives = 223/230 (96.96%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            METFLFTSESVNEGHPDKLCDQISDA+LDACL QDPDSKVACETCTKTN+VMVFG ITTKA+V+YEKIVRDTCR+IGFVSDDVGLDAD CKVLV IEQQSPDIAQGVHGH +KRPEEIGAGDQGHMFGYATDETPEFMPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGA VPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGARVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 230          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK1_ATRNU (S-adenosylmethionine synthetase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2)

HSP 1 Score: 443.736 bits (1140), Expect = 4.641e-124
Identity = 213/230 (92.61%), Postives = 224/230 (97.39%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            ++TFLFTSESVNEGHPDKLCDQISDA+LDACL QDP+SKVACETCTKTNLVMVFG ITTKANV+YEKIVR TCR+IGFVS DVGLDADNCKVLVYIEQQSPDIAQGVHGHLS+RPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLSRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 234          
BLAST of FC929920 vs. ExPASy Swiss-Prot
Match: METK4_ATRNU (S-adenosylmethionine synthetase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.034e-123
Identity = 212/230 (92.17%), Postives = 224/230 (97.39%), Query Frame = 3
Query:   42 METFLFTSESVNEGHPDKLCDQISDAILDACLEQDPDSKVACETCTKTNLVMVFGGITTKANVNYEKIVRDTCRNIGFVSDDVGLDADNCKVLVYIEQQSPDIAQGVHGHLSKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATQLGAKLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP*EYLDEKTIF 731
            ++TFLFTSESVNEGHPDKLCDQISDA+LDACL QDP+SKVACETCTKTNLVMVFG ITTKANV+YEKIVR TCR+IGFVS DVGLDADNCKVLVYIEQQSPDIAQGVHGHL++RPEEIGAGDQGHMFGYATDETPE MPLSHVLAT+LGA+LTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVP+RVHTVLISTQHDETVTNDEIAADLKEHVIKPVIP +YLDEKTIF
Sbjct:    5 VDTFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNLVMVFGEITTKANVDYEKIVRQTCRDIGFVSADVGLDADNCKVLVYIEQQSPDIAQGVHGHLTRRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIF 234          
The following BLAST results are available for this feature:
BLAST of FC929920 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_PETHY2.629e-12794.78S-adenosylmethionine synthetase 3 OS=Petunia hybri... [more]
METK_MESCR1.884e-12593.91S-adenosylmethionine synthetase OS=Mesembryanthemu... [more]
METK1_CATRO1.884e-12593.48S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]
METK2_PEA5.483e-12593.45S-adenosylmethionine synthetase 2 OS=Pisum sativum... [more]
METK1_ELAUM7.160e-12593.48S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK1_POPTR1.595e-12492.17S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK1_SOLTU2.721e-12492.61S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_CARPA4.641e-12493.04S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK1_ATRNU4.641e-12492.61S-adenosylmethionine synthetase 1 OS=Atriplex numm... [more]
METK4_ATRNU1.034e-12392.17S-adenosylmethionine synthetase 4 OS=Atriplex numm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001H03EF PostHarvC1 Citrus clementina cDNA clone C34001H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929920 ID=FC929920|Name=FC929920|organism=Citrus clementina|type=EST|length=733bp
GAATTCTAGATCTACCCGGTTCGCAGTTTTTGAAGAAAAATATGGAGACT
TTTTTGTTCACTTCAGAATCTGTGAACGAGGGTCATCCAGACAAGCTCTG
TGATCAGATCTCCGATGCCATTCTCGATGCTTGTCTCGAACAAGACCCAG
ATAGCAAGGTGGCTTGTGAAACCTGTACCAAGACTAACTTGGTTATGGTT
TTTGGAGGGATCACAACCAAAGCTAATGTTAATTACGAGAAAATTGTTCG
TGACACTTGCCGCAACATTGGATTTGTCTCTGATGATGTGGGTTTGGATG
CTGATAACTGTAAGGTTTTGGTTTACATTGAGCAACAAAGCCCTGATATC
GCCCAGGGCGTTCATGGTCATTTGTCTAAACGCCCCGAGGAAATCGGTGC
TGGTGATCAGGGGCATATGTTTGGTTATGCTACCGATGAGACTCCTGAAT
TTATGCCTCTGAGTCATGTTCTTGCCACCCAGCTTGGTGCTAAACTTACC
GAGGTTCGAAAGAATGGCACTTGCCCTTGGTTGAGGCCTGATGGCAAGAC
ACAAGTTACTGTTGAGTATTACAATGAGAATGGTGCTATGGTTCCTGTGA
GAGTTCACACAGTTTTGATCTCTACTCAGCATGACGAAACTGTGACTAAT
GATGAGATCGCTGCTGATTTGAAAGAGCATGTGATCAAGCCTGTTATTCC
CTGAGAGTACCTTGATGAGAAGACTATCTTCCA
back to top