FC929922

Overview
NameFC929922
Unique NameFC929922
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15114 contig Ccv1_Contig15114:12..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 1.736e-103
Identity = 191/196 (97.45%), Postives = 191/196 (97.45%), Query Frame = 1
Query:   82 MAAMTSTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            MAAM STAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED
Sbjct:    1 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 196          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.296e-74
Identity = 138/174 (79.31%), Postives = 154/174 (88.51%), Query Frame = 1
Query:  148 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQSVSPGGGAWLGGQLFS MVVRKPAH+FLDELGI+YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 192          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 3.530e-72
Identity = 142/197 (72.08%), Postives = 164/197 (83.25%), Query Frame = 1
Query:   82 MAAMTSTAFAPSVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            MAA+ ST    S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQSVSPGGGAWLGGQLFSAM+VRKPAH+FLDE+G+ YDEQD YVV+KHAALFTSTIMSKLLARPNVKLFNAVAAED
Sbjct:    1 MAAIASTL---SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAED 189          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 1.876e-65
Identity = 132/194 (68.04%), Postives = 151/194 (77.84%), Query Frame = 1
Query:  121 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQSVSPGGGAWLGGQLFSAMVVRKPAH+FLDELG+ YDE ++YVVIKHAALFTST+MS LLARPNVKLFNAVA ED
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFNAVAVED 195          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.451e-65
Identity = 129/192 (67.19%), Postives = 150/192 (78.12%), Query Frame = 1
Query:  121 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQSVSPGGGAWLGGQLFSAMVVR+PAH+FLDELG+ YDE ++YVV+KHAALFTST+MS+LLARPNVKLFNAVA ED
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFNAVAVED 192          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 4.346e-46
Identity = 91/147 (61.90%), Postives = 119/147 (80.95%), Query Frame = 1
Query:  235 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+G+ Y+++ +YVV+KHAALFTST+M++ LA PNVKLFNA A ED
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFNATAVED 183          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 4.805e-45
Identity = 90/135 (66.67%), Postives = 107/135 (79.26%), Query Frame = 1
Query:  268 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE SVSPGGGAWLGGQLFSAM++RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN+KLFNA   ED
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNATCVED 178          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 179.489 bits (454), Expect = 1.398e-44
Identity = 91/137 (66.42%), Postives = 111/137 (81.02%), Query Frame = 1
Query:  268 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDE--QDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E SVSPGGGAWLGGQLFSAMV+R+PA +FL+ELG+ Y+E    NYVV+KHA+LFTST+MSK+L+ PNVKLFNA A ED
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFNATAVED 184          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.938e-44
Identity = 89/164 (54.27%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  190 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E +V+PGGG WLGGQL SAMV RKPA  FLD++G+ Y+++ N+VV+KHAALFTST++SK+LA PNVK+FNA A ED
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFNATACED 187          
BLAST of FC929922 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.938e-44
Identity = 90/135 (66.67%), Postives = 105/135 (77.78%), Query Frame = 1
Query:  268 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAED 669
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  PN KLFNA   ED
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFNATCVED 182          
The following BLAST results are available for this feature:
BLAST of FC929922 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
THI4_CITSI1.736e-10397.45Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.296e-7479.31Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH3.530e-7272.08Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE1.876e-6568.04Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE2.451e-6567.19Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO4.346e-4661.90Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX4.805e-4566.67Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR1.398e-4466.42Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_UROFA6.938e-4454.27Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI4_FUSSH6.938e-4466.67Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001H05EF PostHarvC1 Citrus clementina cDNA clone C34001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929922 ID=FC929922|Name=FC929922|organism=Citrus clementina|type=EST|length=671bp
TCATCACTGCTGCAAATCAAATTACTTCTCATTATCAAACTTCTAAGCAG
CAGGGGAAGGAGGGGTTAAAAAAAAAAAAACATGGCAGCCATGACTTCTA
CAGCTTTCGCTCCTTCAGTTTCGTCCACCACCAATAAGCTCTTTGACTCA
TCCTTTCATGGGGCTCCCATGTCACCTTCTCTTCTACGTCTTCAACCCAT
CAAATCTTCTCGTCCCAACAACTTGTCCATTTCTGCTTCTGCTTCTCCTC
CTTATGACTTGAACACTTTCAAGTTTGACCCCATCAAAGAATCCATTGTT
TCTCGTGAAATGACACGCAGGTACATGACGGACATGATCACTTATGCTGA
CACTGATGTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCTCTCTTGTGCTT
ATGAGCTCAGCAAAAACCCCAACATTCAGATTGCTATTATCGAACAGTCT
GTTAGCCCCGGCGGTGGCGCGTGGCTCGGTGGACAGCTCTTCTCTGCCAT
GGTTGTGCGCAAACCAGCCCACATCTTCCTTGACGAGCTTGGCATCGACT
ACGATGAGCAAGACAACTATGTTGTGATCAAGCATGCAGCGCTGTTCACC
TCCACTATAATGAGCAAGCTCCTGGCCCGCCCCAACGTCAAGCTCTTTAA
TGCAGTGGCAGCCGAAGACTT
back to top