FC929924

Overview
NameFC929924
Unique NameFC929924
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length647
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15359 contig Ccv1_Contig15359:2..650. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.881e-75
Identity = 143/192 (74.48%), Postives = 166/192 (86.46%), Query Frame = 3
Query:   51 MASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVYNRK 626
            MA KSKIL IGGTGYIGKFIVEAS KAGH TFVLVRESTLS+P+K++L+D FK+ GV FV GD+ +HESLVKAIKQVDVVISTVGH L+ADQVK+IAAIKEAGNVKRFFPSEFG D DR+H AVEPAK+ ++ KA+IRR VEAEGIP+TYVA++   G+ LPNL+QP A  PP DKVVILG GN KAV+N++
Sbjct:    1 MAGKSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRVH-AVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKE 191          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 7.412e-64
Identity = 129/191 (67.54%), Postives = 148/191 (77.49%), Query Frame = 3
Query:   60 KSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQ--PEATAPPRDKVVILGDGNPKAVYNRK 626
            KSKIL IGGTGYIGKF+VEAS KAGH TF LVRE+TLSDP K + +  FK+LGV  + GD+ +HESLVKAIKQVDVVISTVG   I DQ KII+AIKEAGNVKRF PSEFG+D DR   AVEPAKS +  K +IRR +EAEGIPYTY  +    G++LP L Q  P  T+PPRDKV ILGDGN KAV N++
Sbjct:    5 KSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDRT-SAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKE 194          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.805e-63
Identity = 122/189 (64.55%), Postives = 142/189 (75.13%), Query Frame = 3
Query:   51 MASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            ++ KSKIL IGGTGYIGK++VE S K+GH TF L+RESTL +P KS+L+D FK+ GV  + GD+ N ESL+KAIKQVDVVISTVG     DQV II AIKEAGN+KRF PSEFG D D    A+EPA S + +K +IRR +EAEGIPYTYV        FLPNL Q EA  PPRDKVVI GDGNPKA+Y
Sbjct:    3 VSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFLPSEFGFDVDHAR-AIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRDKVVIFGDGNPKAIY 190          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.823e-55
Identity = 112/200 (56.00%), Postives = 148/200 (74.00%), Query Frame = 3
Query:   51 MASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRES----------TLSDP-SKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            MA+++KIL +G TG IG+ IV AS+KAG+ T+ LVR++          T ++P +K +L+D++++LGV  + GD+ +HE+LVKAIKQVD+VI   G  LI DQVKII AIKEAGNVK+FFPSEFG+D DR H AVEP +  ++ KA IRR +EAEG+PYTY+  +   G+FL NL+Q + T PPRDKVVILGDGN K  Y
Sbjct:    1 MATENKILILGPTGAIGRHIVWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDR-HEAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRDKVVILGDGNVKGAY 199          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 6.290e-55
Identity = 113/200 (56.50%), Postives = 142/200 (71.00%), Query Frame = 3
Query:   51 MASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRES-----------TLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            MAS+++IL +G TG IG+ +V AS+KAG+ T+ L+R++             +  SK +LL  FK  GV  + GD+ +HE+LVKAIKQVD VI T G  LI DQVKII AIKEAGNVKRFFPSEFG+D DR H AV+P +  +D KA IRR VEAEG+PYTY+  +   G+FL NL+Q +AT PPRDKV+ILGDGN K  Y
Sbjct:    1 MASQNRILVLGPTGAIGRHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVKRFFPSEFGLDVDR-HDAVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRDKVIILGDGNVKGAY 199          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 7.689e-53
Identity = 108/200 (54.00%), Postives = 142/200 (71.00%), Query Frame = 3
Query:   51 MASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVREST-----------LSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            MA+++KIL +G TG IG+ IV AS+KAG+ T+ LVR+++            +  +K +LL +++  GV  + GD+ +HE+LV AIKQVD VI   G  LI DQVK+I AIKEAGNVKRFFPSEFG+D DR H AVEP +  ++ KA IRR VE+EG+PYTY+  +   G+FL NL+Q +AT PPRDKVVILGDGN +  Y
Sbjct:    1 MATENKILILGATGAIGRHIVWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVKRFFPSEFGLDVDR-HDAVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRDKVVILGDGNVRGAY 199          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.039e-49
Identity = 103/188 (54.79%), Postives = 129/188 (68.62%), Query Frame = 3
Query:   54 ASKSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            + KSKIL +GGTGY+G+ +V AS + GH T  LVR++  SDP+K+ LL  F++ GV  + GD+ +  SLV A+K  DVVIS +G   IADQ +++ AIKEAGNVKRFFPSEFG+D DR  G VEPAKS    K  IRRA EA GIPYTY  +    G  LP + Q  A  PP DK V+LGDG+ KAV+
Sbjct:    3 SEKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVKRFFPSEFGLDVDRT-GIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPADKAVVLGDGDTKAVF 189          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 7.213e-43
Identity = 91/192 (47.40%), Postives = 127/192 (66.15%), Query Frame = 3
Query:   60 KSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVG------HTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVY 617
            KSK+L +GGTGY+G+ IV+AS++ GH+TF+L R     D  K Q+L  FK  G   V     +H+SLV A+K VDVVI T+       H L+  Q+K++ AIK+AGN+KRF PSEFG+D   +  A+EP + T+D K  +R+A+E   IP+TY+++    G+F  NLSQ +   PPRDKV++ GDGN K VY
Sbjct:    3 KSKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLLT-QLKLVEAIKDAGNIKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRDKVLLYGDGNVKPVY 193          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.192e-37
Identity = 86/188 (45.74%), Postives = 120/188 (63.83%), Query Frame = 3
Query:   60 KSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRE-STLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVYN 620
            K KIL +G TGY+GK++V+AS+  GH T+  V      SD SK QLL  F++LGV    G++  H+ LV   K+VD+VIST+      +Q+K+I AIKEAGN+KRF PSEFG + DR+  A+   ++  D K KIRRA EA GIP+T+V++  L  +F+  L  P   +   ++V I G G+ KAV N
Sbjct:    5 KGKILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVDRVR-ALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKS---EQVTIYGSGDAKAVLN 188          
BLAST of FC929924 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.033e-37
Identity = 85/187 (45.45%), Postives = 121/187 (64.71%), Query Frame = 3
Query:   60 KSKILSIGGTGYIGKFIVEASVKAGHQTFVLVRESTLSDPSKSQLLDHFKNLGVNFVIGDVLNHESLVKAIKQVDVVISTVGHTLIADQVKIIAAIKEAGNVKRFFPSEFGIDDDRIHGAVEPAKSTYDVKAKIRRAVEAEGIPYTYVASYGLNGHFLPNLSQPEATAPPRDKVVILGDGNPKAVYN 620
            KSKIL  GGTGYIG  +V+ S+K GH T+V  R ++    SK+ LLD F++LG   V G++  HE LV+ +K+VDVVIS +    I DQ KI+ AIK AGN+KRF PS+FG+++DRI+ A+ P ++  + K  IRRA+E   IPYTYV++     +F+  L +P     P+D++ + G G  K   N
Sbjct:    7 KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNS----SKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRIN-ALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRP---YDPKDEITVYGTGEAKFAMN 185          
The following BLAST results are available for this feature:
BLAST of FC929924 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU1.881e-7574.48Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_ARATH7.412e-6467.54Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFRH_TOBAC4.805e-6364.55Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFR_MEDSA2.823e-5556.00Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_CICAR6.290e-5556.50Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFR_PEA7.689e-5354.00Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_MAIZE1.039e-4954.79Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFRH_LUPAL7.213e-4347.40Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY1.192e-3745.74Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA2.033e-3745.45Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001H07EF PostHarvC1 Citrus clementina cDNA clone C34001H07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929924 ID=FC929924|Name=FC929924|organism=Citrus clementina|type=EST|length=647bp
TAATTTTTTTTAAAAAAAAACTCCGGAATTGAACTGAACGAGTTTCAGAC
ATGGCATCGAAAAGCAAGATTCTATCCATCGGCGGGACAGGGTACATCGG
TAAATTCATCGTGGAAGCAAGCGTTAAAGCTGGTCACCAGACGTTCGTGC
TCGTGAGAGAATCCACACTCTCTGATCCCTCCAAATCTCAACTCCTCGAC
CACTTCAAAAACCTCGGCGTCAATTTCGTTATCGGAGATGTTTTGAATCA
CGAGAGTTTGGTGAAGGCGATAAAACAAGTGGACGTGGTGATATCAACAG
TTGGTCACACTTTAATAGCCGATCAGGTCAAGATTATTGCTGCCATTAAA
GAAGCCGGCAACGTTAAGAGATTCTTCCCGTCGGAATTTGGAATTGATGA
TGATCGAATCCATGGAGCCGTAGAGCCAGCAAAATCAACGTATGACGTAA
AGGCGAAAATCCGCCGAGCCGTTGAGGCAGAAGGCATTCCGTATACTTAT
GTAGCATCGTACGGTTTGAATGGCCACTTCCTTCCCAATTTGTCGCAGCC
TGAGGCCACTGCCCCCCCTAGGGATAAGGTCGTCATCTTAGGTGATGGAA
ATCCAAAAGCTGTTTATAACAGGAAGATGATGTTGCAACCTTCACCA
back to top