FC929926

Overview
NameFC929926
Unique NameFC929926
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length740
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6173 contig Ccv1_Contig6173:28..767. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.256e-108
Identity = 196/224 (87.50%), Postives = 206/224 (91.96%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA VTE VLAACYKALN+HHVL EGTLL
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 390.578 bits (1002), Expect = 4.771e-108
Identity = 195/224 (87.05%), Postives = 206/224 (91.96%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI++CA V+E VLAACYKALN+HHVL EGTLL
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 3.093e-107
Identity = 193/224 (86.16%), Postives = 205/224 (91.52%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVE+NRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HDI++CA+V+ERVLAACYKALNDHHVL EGT L
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 4.621e-103
Identity = 192/225 (85.33%), Postives = 200/225 (88.89%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HDI+KCA +TERVLAA YKAL+DHHVL EGTLL
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVLLEGTLL 225          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 6.036e-103
Identity = 192/225 (85.33%), Postives = 203/225 (90.22%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVE+NR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HDI KCA +TERVLAA YKAL+DHHV+ EGTLL
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVILEGTLL 225          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.487e-101
Identity = 183/224 (81.70%), Postives = 199/224 (88.84%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+EANR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HDI KCA VTE VLAACYKALND HVL EGTLL
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVLLEGTLL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 333.954 bits (855), Expect = 5.300e-91
Identity = 169/224 (75.45%), Postives = 184/224 (82.14%), Query Frame = 3
Query:   69 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN E+NR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HDI KCA VTE VLAA +KALN HHVL EGTLL
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGTLL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.267e-76
Identity = 150/221 (67.87%), Postives = 174/221 (78.73%), Query Frame = 3
Query:   87 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVPIVEPEIL+DG H + + A+VTE+VLAA +KALNDHH+L EG LL
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALNDHHILLEGALL 224          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.451e-74
Identity = 144/215 (66.98%), Postives = 165/215 (76.74%), Query Frame = 3
Query:   99 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            EL +NA+ I  PGKG+LAADEST TIGKR ++IN+EN E NRRA RELLF T P   +++SGVILF ET+YQKT  GKPFV++L+E GVLPGIKVD G V L GT  E TTQGLD LAQRC +YY  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVPIVEPE+L DG HD+     VTE+VL+  YKAL DHHV  EGTLL
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLSFVYKALADHHVYLEGTLL 229          
BLAST of FC929926 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.507e-74
Identity = 144/215 (66.98%), Postives = 169/215 (78.60%), Query Frame = 3
Query:   99 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEANRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDINKCADVTERVLAACYKALNDHHVLSEGTLL 740
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+  C  VTE+VLAA YKAL+DHHV  EG+LL
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVYLEGSLL 229          
The following BLAST results are available for this feature:
BLAST of FC929926 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_MAIZE1.256e-10887.50Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ4.771e-10887.05Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_SPIOL3.093e-10786.16Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR4.621e-10385.33Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA6.036e-10385.33Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA1.487e-10181.70Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH5.300e-9175.45Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI1.267e-7667.87Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF_ECHMU3.451e-7466.98Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
ALF2_LAMJA4.507e-7466.98Fructose-bisphosphate aldolase, non-muscle type OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34001H09EF PostHarvC1 Citrus clementina cDNA clone C34001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929926 ID=FC929926|Name=FC929926|organism=Citrus clementina|type=EST|length=740bp
GGCATAAAAATCGCTCTCTCTGTTTCTCCCTCTAACAAAACAAATTTTCT
ATCTTCAAGTAGATCACCATGTCTTGCTTCAAGGGCAAATACGCCGATGA
GCTCATTAAAAACGCTGCCTACATTGGCACCCCTGGAAAGGGTATCCTTG
CTGCTGATGAGTCAACAGGCACCATTGGCAAGCGTCTATCCAGCATCAAT
GTTGAGAATGTTGAGGCAAACAGGCGTGCTCTCCGCGAGCTCCTTTTCTG
CACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTCATCCTCTTCGAGGAGA
CCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTTTGTTGATGTCTTGAAG
GAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACAAGGGTACTGTTGAGCT
TGCTGGTACCAATGGTGAGACCACCACCCAGGGTCTTGATGGCCTCGCCC
AGCGCTGCCAGAAATACTATGAAGCTGGTGCTCGTTTTGCCAAATGGCGT
GCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGCAGCTGGCCATCAATGA
GAATGCCAATGGCCTGGCCCGATATGCTATCATCTGCCAGGAGAATGGCC
TTGTTCCCATTGTTGAACCTGAGATCCTTGTTGACGGTCCCCATGACATC
AACAAGTGTGCTGATGTGACCGAGCGTGTTCTTGCTGCATGCTACAAGGC
TCTGAATGACCACCATGTCCTTTCTGAGGGTACCCTTTTG
back to top