FC929928

Overview
NameFC929928
Unique NameFC929928
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5110 contig Ccv1_Contig5110:40..735. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDH1_YEAST (External NADH-ubiquinone oxidoreductase 1, mitochondrial OS=Saccharomyces cerevisiae GN=NDE1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.156e-20
Identity = 60/157 (38.22%), Postives = 90/157 (57.32%), Query Frame = 3
Query:  147 DASPSTVQVTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKEMQLF 617
            +A+PST QV Q S   P  +  K  +V+LGSGW    L+K +DT+LY+VV VSPRN+ +FTPLL ST VGT+E +S+ EP+  I      E   +++ +    +D +N  +  ++          +   + YD LV+ +GA+ +TFG  GV E   F
Sbjct:   93 EANPST-QVPQ-SDTFPNGSKRKT-LVILGSGWGSVSLLKNLDTTLYNVVVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRTIARRSHGE--VHYYEAEAYDVDPENKTIKVKSSAKN----NDYDLDLKYDYLVVGVGAQPNTFGTPGVYEYSSF 240          
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDH_DICDI (Probable NADH dehydrogenase OS=Dictyostelium discoideum GN=DDB_G0270104 PE=3 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 5.738e-20
Identity = 55/165 (33.33%), Postives = 92/165 (55.76%), Query Frame = 3
Query:  111 NLILTCLSHFTTDASPSTVQVTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKE 605
            NLI+   ++ +   + S+++          K  E  ++++LG GW     +K +++  YD+  +SPRNH +FTPLL S+ VGTLEFRS+AEP+       +R+   + ++   A + + N   +   V       +P  F++ YDKLVI +G+  +TFGI GV+E
Sbjct:    5 NLIIRGRNYISDHLTKSSLEKAIIRRQKRGKVIENEKLIILGCGWGSYSFLKNLNSIKYDITVISPRNHFLFTPLLTSSAVGTLEFRSIAEPV-----RTTRDINEFKYIQ--ASVTSINPENNSVLVKSTFHNEKP--FEMKYDKLVIGVGSRNNTFGIKGVEE 160          
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDH2_YEAST (External NADH-ubiquinone oxidoreductase 2, mitochondrial OS=Saccharomyces cerevisiae GN=NDE2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.278e-19
Identity = 62/168 (36.90%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  129 LSHFTTDASPSTVQVTQYSGLGPTK--------AN--EKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFL-SHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGV 599
            L+ +TT A    V    Y    P K        AN  +K  +V+LG+GW    L+K +DTSLY+V  VSPR+  +FTPLL ST VGT+E +S+ EP+  I     R PG   ++ +    +D     V  ++V+++    E +   +SYD LV+++GA+ +TF I GV
Sbjct:   59 LTFYTTLAGTLYVSYELYKESNPPKQVPQSTAFANGLKKKELVILGTGWGAISLLKKLDTSLYNVTVVSPRSFFLFTPLLPSTPVGTIEMKSIVEPVRSI---ARRTPGEVHYIEAEALDVDPKAKKVMVQSVSED----EYFVSSLSYDYLVVSVGAKTTTFNIPGV 219          
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDH1_SCHPO (Probable NADH-ubiquinone oxidoreductase C3A11.07, mitochondrial OS=Schizosaccharomyces pombe GN=SPAC3A11.07 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.278e-19
Identity = 55/143 (38.46%), Postives = 79/143 (55.24%), Query Frame = 3
Query:  195 PTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSY--FFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKEMQLF 617
            P     K  +VVLG+GW    +++ IDTSL++V+ VSPRN+ +FT LL ST  G++  RS+ +PI      + R    Y  F+ + C  +D D  V+H +  T +   LE    +I YD LV + GAE  TF I G+ E   F
Sbjct:   85 PLPDPSKKTLVVLGAGWGATSILRTIDTSLFNVIVVSPRNYFLFTSLLPSTATGSVHTRSIVQPIR----YMLRHKSCYVKFYEAECTDVDADKKVIHIKKTTTDGVDLEQ---EIKYDYLVCSHGAETQTFNIPGIAEYGCF 220          
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDI1_YEAST (Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae GN=NDI1 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.286e-19
Identity = 59/182 (32.42%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  117 ILTCLSHFTTDASPSTVQVTQYSGLGPT----------KANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKF---------KISYDKLVIALGAEASTFGIHGVKE 605
            +LT  +     AS  +  V + SG GPT          + ++KP V++LGSGW     +K IDT  Y+V  +SPR++ +FTPLL S  VGT++ +S+ EPI     A+ ++    ++ +    I+ D + V  ++++   +  +P            +I YD L+ A+GAE +TFGI GV +
Sbjct:   12 LLTSTNTLVRFASTRSTGV-ENSGAGPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNF--ALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTD 190          
BLAST of FC929928 vs. ExPASy Swiss-Prot
Match: NDH2_SCHPO (Probable NADH-ubiquinone oxidoreductase C947.15c, mitochondrial OS=Schizosaccharomyces pombe GN=SPBC947.15c PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.149e-18
Identity = 54/135 (40.00%), Postives = 71/135 (52.59%), Query Frame = 3
Query:  213 KPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKEMQLF 617
            K  +VVLGSGW     +K +D SLY++  VSPR+H +FTP+L S  VGTL   S+ EPI  +     +   S    + C  IDT    V   T+       E  +  I YD LV A+GA   TFGI GV++   F
Sbjct:   90 KKNIVVLGSGWGAVAAIKNLDPSLYNITLVSPRDHFLFTPMLPSCTVGTLRLPSITEPIVALFK--GKIDPSNIHQAECTAIDTSAKKV---TIRGTTEANEGKEAVIPYDTLVFAIGAGNQTFGIQGVRDHGCF 219          
The following BLAST results are available for this feature:
BLAST of FC929928 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
NDH1_YEAST1.156e-2038.22External NADH-ubiquinone oxidoreductase 1, mitocho... [more]
NDH_DICDI5.738e-2033.33Probable NADH dehydrogenase OS=Dictyostelium disco... [more]
NDH2_YEAST1.278e-1936.90External NADH-ubiquinone oxidoreductase 2, mitocho... [more]
NDH1_SCHPO1.278e-1938.46Probable NADH-ubiquinone oxidoreductase C3A11.07, ... [more]
NDI1_YEAST8.286e-1932.42Rotenone-insensitive NADH-ubiquinone oxidoreductas... [more]
NDH2_SCHPO3.149e-1840.00Probable NADH-ubiquinone oxidoreductase C947.15c, ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34001H11EF PostHarvC1 Citrus clementina cDNA clone C34001H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929928 ID=FC929928|Name=FC929928|organism=Citrus clementina|type=EST|length=695bp
GCTGCAAAACCAAATAAGCAGCTTCCGTTATGTCTTTGTTCAAGCATCTT
CTCAGAAACCCCACAGCAAAATCGTATTCATATTCATCACCATCAATAAT
AATGCCCTCCAACTTGATTCTCACTTGCCTCTCACACTTCACAACTGACG
CGTCACCGTCGACGGTGCAGGTGACGCAGTACTCGGGTCTGGGGCCCACT
AAGGCAAATGAGAAGCCCAGGGTGGTGGTGCTGGGCTCTGGCTGGGCGGG
GTGCAGGCTGATGAAGGGCATAGATACGAGTTTATACGACGTCGTTTGCG
TGTCCCCGAGGAATCACATGGTGTTTACTCCTCTTTTGGCCTCTACTTGC
GTCGGCACGCTTGAGTTCAGGTCTGTGGCCGAACCCATTGCCAGGATTCA
GCCTGCTATTTCGAGGGAACCCGGGTCTTACTTTTTCCTCTCCCATTGCG
CTGGCATCGATACTGATAATCATGTGGTGCACTGCGAGACTGTGACGGAT
GAATTAAGGACCTTGGAGCCGTGGAAGTTTAAAATCTCATATGACAAGTT
GGTTATAGCATTGGGAGCAGAGGCCTCGACTTTTGGAATCCATGGTGTGA
AAGAAATGCAACTTTTCTTCGTGAAGTTCATCATGCTCAGGAAATTCGTA
GGAAGCTACTCCTGAACTTGATGCTGTCTGATGNTCCTGGGATAT
back to top