FC929930

Overview
NameFC929930
Unique NameFC929930
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length639
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929930_ssr331 microsatellite FC929930_ssr331:331..342. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15190 contig Ccv1_Contig15190:479..1117. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP13_ARATH (Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 3.825e-57
Identity = 104/134 (77.61%), Postives = 114/134 (85.07%), Query Frame = 2
Query:    2 TFISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDDE----PKKNGHRNGFDPVSQL 391
            T+++AFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTF+IAQAFLSMLCHFKFGIF+FFS WVLIMS FV FLLPETKN+PIEEMTERVWK+HW W  FM  D  +D E     K NG  NGFDP ++L
Sbjct:  395 TYVAAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFIIAQAFLSMLCHFKFGIFIFFSAWVLIMSVFVMFLLPETKNIPIEEMTERVWKKHWFWARFM--DDHNDHEFVNGEKSNGKSNGFDPSTRL 526          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP7_ARATH (Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 8.272e-44
Identity = 81/115 (70.43%), Postives = 93/115 (80.87%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDDEPK 349
            F+ AF WSWGPLGW IPSE FPLETRSAGQS+TV VNLLFTF+IAQAFL +LC FKFGIFLFF+GWV +M+ FV+FLLPETK VPIEEMT  +W +HW WK  + D    +DE K
Sbjct:  396 FVVAFGWSWGPLGWTIPSEIFPLETRSAGQSITVAVNLLFTFIIAQAFLGLLCAFKFGIFLFFAGWVTVMTIFVYFLLPETKGVPIEEMT-LLWSKHWFWKKVLPDATNLEDESK 509          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP6_ARATH (Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.843e-41
Identity = 72/117 (61.54%), Postives = 88/117 (75.21%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDDEPKKN 355
            ++  FAWSWGPLGWLIPSETFPLETRSAG +V V  N+ FTFVIAQAFLSMLC  + GIF FFSGW+++M  F FF +PETK + I++M E VWK HW WK +M+ +    D  K+N
Sbjct:  390 YVMGFAWSWGPLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLSMLCGMRSGIFFFFSGWIIVMGLFAFFFIPETKGIAIDDMRESVWKPHWFWKRYMLPEDDHHDIEKRN 506          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STC_RICCO (Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.019e-41
Identity = 73/109 (66.97%), Postives = 89/109 (81.65%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGF 331
            ++S FAWSWGPLGWL+PSE FPLE RSA QSV V VN+ FTFV+AQ FL MLCH KFG+F+FFS +VLIMS FV++ LPETK +PIEEM + VWKQHW W  ++VD+ +
Sbjct:  399 YVSGFAWSWGPLGWLVPSEIFPLEIRSAAQSVNVSVNMFFTFVVAQVFLIMLCHLKFGLFIFFSFFVLIMSIFVYYFLPETKGIPIEEMGQ-VWKQHWYWSRYVVDEDY 506          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: HEX6_RICCO (Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.253e-40
Identity = 70/112 (62.50%), Postives = 89/112 (79.46%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDD 340
            +++ F WSWGPLGWL+PSE FPLE RSAGQS+ V V+ LFTFV+AQ FLSMLCHFK GIF FF GWV++M+ FV FLLPETK VPIE+M + VW+ HW WK  + ++  +++
Sbjct:  394 YVAGFGWSWGPLGWLVPSEIFPLEIRSAGQSIVVAVSFLFTFVVAQTFLSMLCHFKSGIFFFFGGWVVVMTAFVHFLLPETKKVPIEKM-DIVWRDHWFWKKIIGEEAAEEN 504          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STA_RICCO (Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.549e-40
Identity = 74/112 (66.07%), Postives = 87/112 (77.68%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDD 340
            F+ AF WSWGPLGW +PSE FPLETRSAGQS+TV VNL FTFVIAQ+F S+LC FKFGIFLFF+GWV +M+ FV+  LPETK VPIEEM   +W++HW WK  +      DD
Sbjct:  396 FVLAFGWSWGPLGWTVPSEIFPLETRSAGQSITVAVNLFFTFVIAQSFPSLLCAFKFGIFLFFAGWVTVMTAFVYIFLPETKGVPIEEMI-FLWRKHWFWKKIVPGQPEVDD 506          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP8_ARATH (Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.135e-39
Identity = 69/115 (60.00%), Postives = 86/115 (74.78%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDDEPK 349
            ++  FAWSWGPLGWLIPSETFPLETR+ G ++ V  N+ FTFVIAQAFLSMLC  K GIF FFSGW+++M  F  F +PETK V I++M + VWK HW WK FM+++   D E +
Sbjct:  391 YVMGFAWSWGPLGWLIPSETFPLETRTEGFALAVSCNMFFTFVIAQAFLSMLCAMKSGIFFFFSGWIVVMGLFALFFVPETKGVSIDDMRDSVWKLHWYWKRFMLEEDEHDVEKR 505          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP12_ARATH (Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.046e-38
Identity = 68/104 (65.38%), Postives = 86/104 (82.69%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFM 316
            +++AFAWSWGPLGWL+PSE FPLE RSA QS+TV VN++FTF+IAQ FL MLCH KFG+F+FF+ +V++MS FV+  LPET+ VPIEEM  RVW+ HW W  F+
Sbjct:  395 YVAAFAWSWGPLGWLVPSEIFPLEIRSAAQSITVSVNMIFTFLIAQVFLMMLCHLKFGLFIFFAFFVVVMSIFVYLFLPETRGVPIEEM-NRVWRSHWYWSKFV 497          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP1_ARATH (Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.367e-38
Identity = 71/123 (57.72%), Postives = 94/123 (76.42%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDDGFDDD-EPKKNGHRNG 370
            +++ FAWSWGPLGWL+PSE FPLE RSA QS+TV VN++FTF+IAQ FL+MLCH KFG+FL F+ +V++MS FV+  LPETK +PIEEM + VW+ HW W  F+ D  + +  E  KN ++ G
Sbjct:  397 YVAGFAWSWGPLGWLVPSEIFPLEIRSAAQSITVSVNMIFTFIIAQIFLTMLCHLKFGLFLVFAFFVVVMSIFVYIFLPETKGIPIEEMGQ-VWRSHWYWSRFVEDGEYGNALEMGKNSNQAG 518          
BLAST of FC929930 vs. ExPASy Swiss-Prot
Match: STP10_ARATH (Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.367e-38
Identity = 71/116 (61.21%), Postives = 89/116 (76.72%), Query Frame = 2
Query:    5 FISAFAWSWGPLGWLIPSETFPLETRSAGQSVTVCVNLLFTFVIAQAFLSMLCHFKFGIFLFFSGWVLIMSCFVFFLLPETKNVPIEEMTERVWKQHWLWKNFMVDD----GFDDD 340
            +++ FAWSWGPLGWL+PSE  PLE R AGQ++ V VN+ FTF+I Q FL+MLCH KFG+F FF+  V IM+ F++FLLPETK VPIEEM  RVWKQHW WK ++ +D    G DD+
Sbjct:  397 YVAGFAWSWGPLGWLVPSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLTMLCHMKFGLFYFFASMVAIMTVFIYFLLPETKGVPIEEM-GRVWKQHWFWKKYIPEDAIIGGHDDN 511          
The following BLAST results are available for this feature:
BLAST of FC929930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
STP13_ARATH3.825e-5777.61Sugar transport protein 13 OS=Arabidopsis thaliana... [more]
STP7_ARATH8.272e-4470.43Sugar transport protein 7 OS=Arabidopsis thaliana ... [more]
STP6_ARATH3.843e-4161.54Sugar transport protein 6 OS=Arabidopsis thaliana ... [more]
STC_RICCO5.019e-4166.97Sugar carrier protein C OS=Ricinus communis GN=STC... [more]
HEX6_RICCO3.253e-4062.50Hexose carrier protein HEX6 OS=Ricinus communis GN... [more]
STA_RICCO5.549e-4066.07Sugar carrier protein A OS=Ricinus communis GN=STA... [more]
STP8_ARATH6.135e-3960.00Sugar transport protein 8 OS=Arabidopsis thaliana ... [more]
STP12_ARATH1.046e-3865.38Sugar transport protein 12 OS=Arabidopsis thaliana... [more]
STP1_ARATH1.367e-3857.72Sugar transport protein 1 OS=Arabidopsis thaliana ... [more]
STP10_ARATH1.367e-3861.21Sugar transport protein 10 OS=Arabidopsis thaliana... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34002A01EF PostHarvC1 Citrus clementina cDNA clone C34002A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929930 ID=FC929930|Name=FC929930|organism=Citrus clementina|type=EST|length=639bp
CACTTTCATCTCTGCCTTTGCTTGGTCTTGGGGACCTCTCGGATGGCTGA
TTCCCAGCGAAACATTCCCGTTAGAGACGCGATCAGCTGGACAGAGTGTT
ACTGTTTGTGTGAACTTGCTGTTCACTTTTGTGATAGCTCAGGCATTCCT
TTCAATGCTCTGCCATTTCAAGTTCGGCATCTTCTTGTTCTTCTCCGGTT
GGGTTTTGATCATGTCATGCTTTGTGTTTTTCTTGCTCCCCGAGACAAAG
AATGTGCCGATTGAAGAGATGACTGAGAGAGTGTGGAAGCAGCATTGGTT
GTGGAAGAATTTTATGGTTGACGATGGTTTTGATGATGATGAACCGAAGA
AAAATGGGCATCGCAATGGGTTTGACCCCGTTTCCCAGTTGTAAATTTAA
GAAGGCTTTAAATAATGATGTTGCTATAATAGAATTAATACGTATACGTT
AGGTAAGAAATATATTGGTGGCGGTCTCTGTGTCATGAAGAAATTAGTGT
ACAATCCTTTGAGAGAGTGTTCGATCTGGAGCTCTGGCCTGCTATGTGCA
ACAAGGGATGTTTCAAAAGAGAAATCATTCGGTTTGATAATGATATCTGT
AAGTGCAAACTTTTCGGAGCAATATAACTTTTTTGGTAC
back to top