FC929935

Overview
NameFC929935
Unique NameFC929935
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE1_ARATH (Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 2.014e-121
Identity = 208/233 (89.27%), Postives = 219/233 (93.99%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVDPDEVNALAQLMTWKTAVA IPYGGAKGGIGC+P  LSISELERLTRVFTQKIHDLIGIH DVPAPDMGTGPQTMAWILDEYSKFHG+SPAVVTGKPIDLGGSLGRDAATGRGV+F TEALLNEHGK I+GQRFVIQGFGNVGSWAA+LI EKGGKIVAVSDI+GAIKN  GID+P+LLKH KEHRGVKGF G D ID NSIL+EDCD+L+PAALGGVINR
Sbjct:   64 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSKLSISELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLGRDAATGRGVMFGTEALLNEHGKTISGQRFVIQGFGNVGSWAAKLISEKGGKIVAVSDITGAIKNKDGIDIPALLKHTKEHRGVKGFDGADPIDPNSILVEDCDILVPAALGGVINR 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHEB_NICPL (Glutamate dehydrogenase B OS=Nicotiana plumbaginifolia GN=GDHB PE=2 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.305e-120
Identity = 209/233 (89.70%), Postives = 221/233 (94.85%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC+P DLSISELERLTRVFTQKIHDLIG+H DVPAPDMGT PQTMAWILDEYSKFHG+SPAVVTGKPIDLGGSLGRDAATGRGVLFA EALL +HGK+IAGQRFV+QGFGNVGSWAA+LI E+GGKIVAVSDI+GAIKN  GID+ SLLKHVKE+RGVKGF G DSID NSIL+EDCDVLIPAALGGVINR
Sbjct:   64 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCSPSDLSISELERLTRVFTQKIHDLIGVHTDVPAPDMGTNPQTMAWILDEYSKFHGYSPAVVTGKPIDLGGSLGRDAATGRGVLFAAEALLRDHGKSIAGQRFVVQGFGNVGSWAAQLITEQGGKIVAVSDITGAIKNKNGIDIASLLKHVKENRGVKGFHGADSIDPNSILVEDCDVLIPAALGGVINR 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE3_SOLLC (Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 3.215e-119
Identity = 206/233 (88.41%), Postives = 219/233 (93.99%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC+P DLSISELERLTRVFTQKIHDLIGIH DVPAPDMGT PQTMAWILDEYSKFHG+SPAVVTGKP+DLGGSLGRDAATGRG LFATEALLNEHGK++AGQRFVIQGFGNVGSWAA+LI E+GGK+VAVSDI+GAIKN KGID+ SL KHVKE RGVKGF     ID+NSIL+EDCDVLIPAALGGVIN+
Sbjct:   64 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCSPSDLSISELERLTRVFTQKIHDLIGIHTDVPAPDMGTNPQTMAWILDEYSKFHGYSPAVVTGKPVDLGGSLGRDAATGRGALFATEALLNEHGKSVAGQRFVIQGFGNVGSWAAKLIHEQGGKVVAVSDITGAIKNEKGIDIESLFKHVKETRGVKGFHDAHPIDANSILVEDCDVLIPAALGGVINK 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE3_ARATH (Probable glutamate dehydrogenase 3 OS=Arabidopsis thaliana GN=GSH3 PE=1 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 4.199e-119
Identity = 202/233 (86.70%), Postives = 221/233 (94.85%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEV+PDEVNALAQLMTWKTAVA IPYGGAKGGIGC+P +LS+SELERLTRVFTQKIHDLIGIH DVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGK I+GQRF IQGFGNVGSWAA+LI +KGGKIVAVSD++GAIKN+ GID+ SLL+H +E+RG+KGF G DSID +SIL+EDCD+L+PAALGGVINR
Sbjct:   64 PMKGGIRYHPEVEPDEVNALAQLMTWKTAVAKIPYGGAKGGIGCDPSELSLSELERLTRVFTQKIHDLIGIHTDVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKTISGQRFAIQGFGNVGSWAAKLISDKGGKIVAVSDVTGAIKNNNGIDILSLLEHAEENRGIKGFDGADSIDPDSILVEDCDILVPAALGGVINR 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE3_MAIZE (Glutamate dehydrogenase OS=Zea mays GN=GDH1 PE=1 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.183e-113
Identity = 194/233 (83.26%), Postives = 215/233 (92.27%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYH EVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGC+PGDLSISELERLTRVFTQKIHDLIGIH DVPAPDMGT  QTMAWILDEYSKFHG+SPAVVTGKP+DLGGSLGRDAATGRGVLFATEALL EHGK IAGQRFVIQGFGNVGSWAA+LI E GGK++A+SD++GA+KN  G+D+  L+KH  E++G+KGF GGD+I  +S+L E+CDVLIPAALGGVIN+
Sbjct:   64 PMKGGIRYHHEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCSPGDLSISELERLTRVFTQKIHDLIGIHTDVPAPDMGTNSQTMAWILDEYSKFHGYSPAVVTGKPVDLGGSLGRDAATGRGVLFATEALLAEHGKGIAGQRFVIQGFGNVGSWAAQLISEAGGKVIAISDVTGAVKNVDGLDIAQLVKHSAENKGIKGFKGGDAIAPDSLLTEECDVLIPAALGGVINK 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE2_ARATH (Glutamate dehydrogenase 2 OS=Arabidopsis thaliana GN=GDH2 PE=1 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.816e-107
Identity = 185/233 (79.40%), Postives = 211/233 (90.56%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVDPDEVNALAQLMTWKTAVA+IPYGGAKGGIGC+P DLS+SELERLTRVFTQKIHDLIGIH DVPAPDMGT  QTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGR+AATGRGV+FATEALL E+GK+I G  FVIQGFGNVG+WAA+LI EKGGK+VAVSDI+GAI+N +GID+ +L+KH      +  F+GGD+++S+ +LI +CDVLIP ALGGV+N+
Sbjct:   64 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCSPRDLSLSELERLTRVFTQKIHDLIGIHTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGRGVVFATEALLAEYGKSIQGLTFVIQGFGNVGTWAAKLIHEKGGKVVAVSDITGAIRNPEGIDINALIKHKDATGSLNDFNGGDAMNSDELLIHECDVLIPCALGGVLNK 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE3_VITVI (Glutamate dehydrogenase OS=Vitis vinifera GN=GDH PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.390e-106
Identity = 183/233 (78.54%), Postives = 204/233 (87.55%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVDPDEVNALAQLMTWKTAV +IPYGGAKGGIGC P DLS+SELERLTRVFTQKIHDLIG H DVPAPDMGT  QTMAWILDEYSKFHGHSPAVVTGKPI LGGSLGR+AATGRGV+FATEALL +HGK+I G  FVIQGFGNVGSW ARLIGE+GGKI+AVSD++GA+KN  G+D+  LL+H +E   +  FSGGD +D N +L  +CDVLIP ALGGV+N+
Sbjct:   64 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVVDIPYGGAKGGIGCTPKDLSMSELERLTRVFTQKIHDLIGTHTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIALGGSLGREAATGRGVVFATEALLAQHGKSIKGLTFVIQGFGNVGSWVARLIGERGGKIIAVSDVTGAVKNQNGLDIVDLLRHKEETGCLTNFSGGDHMDPNELLTHECDVLIPCALGGVLNK 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHEA_NICPL (Glutamate dehydrogenase A OS=Nicotiana plumbaginifolia GN=GDHA PE=2 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 7.196e-103
Identity = 179/233 (76.82%), Postives = 204/233 (87.55%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVINR 700
            PMKGGIRYHPEVD DEVNALAQLMTWKTAVA+IPYGGAKGGIGC P DLS SELERLTRVFTQKIHDLIGI+ DVPAPDMGT  QTMAWILDEYSKFHGHSPA+VTGKPIDLGGSLGR+AATGRGV++ATEALL E+GKNI    F IQGFGNVG+WAA+LI E+GGK++AVSDI+GA+KN  G+D+P+LL H +    +  FSGGD ++S+ +L  +CDVLIP ALGGV+NR
Sbjct:   64 PMKGGIRYHPEVDLDEVNALAQLMTWKTAVADIPYGGAKGGIGCKPKDLSKSELERLTRVFTQKIHDLIGINTDVPAPDMGTNAQTMAWILDEYSKFHGHSPAIVTGKPIDLGGSLGREAATGRGVVYATEALLAEYGKNIKDLTFAIQGFGNVGAWAAKLIHERGGKVIAVSDITGAVKNPNGLDIPALLNHKEATGKLIDFSGGDVMNSDEVLTHECDVLIPCALGGVLNR 296          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE41_HALSA (NAD-specific glutamate dehydrogenase A OS=Halobacterium salinarium GN=gdhA PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.969e-57
Identity = 117/235 (49.79%), Postives = 156/235 (66.38%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGH-SPAVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIGEKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSN-SILIEDCDVLIPAALGGVINR 700
            P KGG+RYHP+V  DE   L   MTWK AV ++P+GGAKGG+  NP +LS  E ERLTR FTQ+I D+IG + D+PAPDMGT PQTMAW++D YS   G  +P VVTGKP  +GGS GR+ A GR V   T+ +   + + +      +QG+G+VG+ AARL+ + G  IVA+SD++GA+    GID  S+  H +E   V  ++  D++ SN  +L  D DVLIPAALG VI +
Sbjct:   88 PYKGGLRYHPDVTRDECVGLGMWMTWKCAVMDLPFGGAKGGVAVNPKELSPEEKERLTRRFTQEIRDVIGPNQDIPAPDMGTDPQTMAWLMDAYSMQEGETTPGVVTGKPPVVGGSEGREEAPGRSVAIITQLVCEYYDQPLDETTVAVQGYGSVGANAARLLDKWGATIVAISDVNGAMYEPDGIDTASVPSHDEEPEAVTTYA--DTVISNEELLTLDVDVLIPAALGNVITK 320          
BLAST of FC929935 vs. ExPASy Swiss-Prot
Match: DHE3_THEMA (Glutamate dehydrogenase OS=Thermotoga maritima GN=gdhA PE=1 SV=4)

HSP 1 Score: 219.164 bits (557), Expect = 1.737e-56
Identity = 117/234 (50.00%), Postives = 152/234 (64.96%), Query Frame = 2
Query:    2 PMKGGIRYHPEVDPDEVNALAQLMTWKTAVANIPYGGAKGGIGCNPGDLSISELERLTRVFTQKIHDLIGIHADVPAPDMGTGPQTMAWILDEYSKFHGHSP-AVVTGKPIDLGGSLGRDAATGRGVLFATEALLNEHGKNIAGQRFVIQGFGNVGSWAARLIG-EKGGKIVAVSDISGAIKNSKGIDVPSLLKHVKEHRGVKGFSGGDSIDSNSILIEDCDVLIPAALGGVIN 697
            P KGGIRYHP+V  DEV ALA  MTWKTAV N+P+GG KGG+  +P  LS +ELERL+R F  +I  +IG + D+PAPD+ T    MAW +D YS   GH+   +VTGKP++LGGS GR+ ATGRGV       ++  G +       +QGFGNVG +AA LI  E G K+VAVSD  G I N +G DV  L+++ KEH  V  +  G+ I +  +L  D D+L+PAAL G I+
Sbjct:   67 PAKGGIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRRFFSEIQVIIGPYNDIPAPDVNTNADVMAWYMDTYSMNVGHTVLGIVTGKPVELGGSKGREEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAVSDSRGGIYNPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLELDVDILVPAALEGAIH 300          
The following BLAST results are available for this feature:
BLAST of FC929935 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
DHE1_ARATH2.014e-12189.27Glutamate dehydrogenase 1 OS=Arabidopsis thaliana ... [more]
DHEB_NICPL1.305e-12089.70Glutamate dehydrogenase B OS=Nicotiana plumbaginif... [more]
DHE3_SOLLC3.215e-11988.41Glutamate dehydrogenase OS=Solanum lycopersicum GN... [more]
DHE3_ARATH4.199e-11986.70Probable glutamate dehydrogenase 3 OS=Arabidopsis ... [more]
DHE3_MAIZE1.183e-11383.26Glutamate dehydrogenase OS=Zea mays GN=GDH1 PE=1 S... [more]
DHE2_ARATH4.816e-10779.40Glutamate dehydrogenase 2 OS=Arabidopsis thaliana ... [more]
DHE3_VITVI2.390e-10678.54Glutamate dehydrogenase OS=Vitis vinifera GN=GDH P... [more]
DHEA_NICPL7.196e-10376.82Glutamate dehydrogenase A OS=Nicotiana plumbaginif... [more]
DHE41_HALSA5.969e-5749.79NAD-specific glutamate dehydrogenase A OS=Halobact... [more]
DHE3_THEMA1.737e-5650.00Glutamate dehydrogenase OS=Thermotoga maritima GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34002A06EF PostHarvC1 Citrus clementina cDNA clone C34002A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929935 ID=FC929935|Name=FC929935|organism=Citrus clementina|type=EST|length=702bp
ACCTATGAAGGGGGGAATCAGATATCATCCTGAGGTTGACCCAGATGAGG
TTAATGCATTAGCTCAACTCATGACATGGAAGACAGCTGTAGCAAATATC
CCATATGGTGGTGCTAAAGGTGGAATAGGATGTAATCCAGGGGATTTAAG
CATATCTGAGCTAGAGAGGCTTACCAGAGTTTTTACCCAAAAGATTCATG
ATCTGATAGGAATTCATGCAGATGTTCCTGCTCCTGATATGGGGACAGGT
CCTCAGACTATGGCATGGATACTGGATGAGTATTCCAAATTTCATGGCCA
CTCGCCAGCAGTTGTAACGGGAAAACCCATTGATCTTGGCGGGTCTCTAG
GCAGAGATGCAGCTACAGGAAGAGGAGTGCTTTTTGCTACGGAGGCCCTG
CTCAATGAGCACGGGAAGAACATTGCTGGACAACGATTTGTTATACAGGG
TTTTGGAAATGTCGGTTCCTGGGCTGCTCGACTAATTGGTGAAAAAGGTG
GGAAGATTGTTGCTGTAAGTGACATCTCTGGAGCCATCAAAAACAGCAAA
GGCATTGATGTTCCAAGTCTACTTAAGCATGTAAAGGAACATCGCGGTGT
TAAAGGATTCAGTGGTGGAGATTCGATAGATTCAAATTCGATATTGATTG
AGGACTGTGACGTTCTCATCCCTGCAGCCCTTGGGGGAGTCATCAATAGG
GA
back to top