FC930165

Overview
NameFC930165
Unique NameFC930165
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length778
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RM24_BOVIN (39S ribosomal protein L24, mitochondrial OS=Bos taurus GN=MRPL24 PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.320e-17
Identity = 50/137 (36.50%), Postives = 75/137 (54.74%), Query Frame = 3
Query:  213 WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKI-RTTPRPTVAGPKDTPVDLVMEKTY 620
            W +  GD V I+ GKD G+ G + +VIR +N V+VEG N                   EAP+  + V+++DP+  KP +V  ++ E G +VRV+     SG IIP+P++ +     P   + GPKDT V+  +EKTY
Sbjct:   54 WHLFCGDRVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDFRGTMVPSEAPLLHNQVKLVDPMDRKPTEVEWRFTEAGERVRVST---RSGRIIPKPDVPRADGIVPETWIDGPKDTSVEDALEKTY 187          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_RICPR (50S ribosomal protein L24 OS=Rickettsia prowazekii GN=rplX PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.590e-16
Identity = 47/103 (45.63%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSII 524
            K+ +GD V+II GK KG+ G + +V   +N V+V G NLV               T E+PIH SN+  +DP TG P KV  K+LEDG+KVRVA+    SG II
Sbjct:    5 KVKKGDEVVIITGKYKGKKGKVLKVFPEENTVVVSGVNLVKKHTKPNKMSEGGIITQESPIHISNIAHIDPKTGNPTKVAFKFLEDGSKVRVAK---KSGEII 104          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_RHOCS (50S ribosomal protein L24 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplX PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.076e-16
Identity = 48/103 (46.60%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSII 524
            KI + D V+++ GKDKG+TG +  V+  +NRV V G NLV                +EA +H SNV  +DP T KP +VG K LEDG KVRVA+   ASG II
Sbjct:    4 KIRKNDRVVVLTGKDKGKTGEVIEVLPKENRVKVRGVNLVKKHQRPTPTQQGGIVEIEAALHVSNVAHIDPKTSKPTRVGFKTLEDGRKVRVAK---ASGEII 103          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RM24_XENLA (Probable 39S ribosomal protein L24, mitochondrial OS=Xenopus laevis GN=mrpl24 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.712e-16
Identity = 48/138 (34.78%), Postives = 75/138 (54.35%), Query Frame = 3
Query:  213 WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIR--TTPRPTVAGPKDTPVDLVMEKTY 620
            W+  RGD V ++ GKD G+ G + +V+R++N V+V+G N                   E P+  + V ++DP   KP ++  +Y E+G +VRV+     SG IIP+P +L+ R    P     GPKDT V+  +E+TY
Sbjct:   54 WQYFRGDTVEVLHGKDAGKQGKVTQVVRARNWVVVDGLNTHFRYVGRTDEYRGTYVASEGPLLLNQVSLIDPTDRKPTEIEWRYTEEGERVRVS---ARSGRIIPKP-VLQRRDGIIPEQWKDGPKDTSVEDALERTY 187          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_RICTY (50S ribosomal protein L24 OS=Rickettsia typhi GN=rplX PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.712e-16
Identity = 46/103 (44.66%), Postives = 61/103 (59.22%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSII 524
            K+ +GD V+++ GK KG+ G + +V   +N VIV G NLV               T E+PIH SNV  +DP TG P KV  K+LEDG+KVR+A+    SG II
Sbjct:    5 KVKKGDEVIVVTGKYKGKKGKVLKVFIDENTVIVSGVNLVKKHTKPNKMSEGGIITKESPIHISNVAHIDPKTGNPTKVAFKFLEDGSKVRIAK---KSGEII 104          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_RICFE (50S ribosomal protein L24 OS=Rickettsia felis GN=rplX PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.542e-16
Identity = 47/103 (45.63%), Postives = 60/103 (58.25%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSII 524
            K+ +GD V++I GK KG+ G I +V    ++VIV G NLV               T E PIH SN+  +DP TG P KV  K+LEDG+KVRVA+    SG II
Sbjct:    5 KVKKGDEVVVITGKHKGKKGKILKVFPEDSKVIVSGVNLVKKHTKPNQMSEGGIITKELPIHISNIAHIDPKTGNPTKVAFKFLEDGSKVRVAK---KSGEII 104          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_FRASN (50S ribosomal protein L24 OS=Frankia sp. (strain EAN1pec) GN=rplX PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 3.542e-16
Identity = 45/102 (44.12%), Postives = 60/102 (58.82%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXX----FTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGA 509
            KI +GD V I+ GKD+G  G + R I  QN+V+VEG N V                   T EAPIH SNV ++DP  G+P +VG ++ +DGTKVR++R  GA
Sbjct:    5 KIKKGDTVQIVTGKDRGLKGKVIRAIPDQNKVVVEGANRVTRHTRVQQSSRGSQSGGIVTQEAPIHVSNVMIVDPSDGRPTRVGYRFNDDGTKVRISRRTGA 106          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RM24_DANRE (Probable 39S ribosomal protein L24, mitochondrial OS=Danio rerio GN=mrpl24 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.626e-16
Identity = 47/137 (34.31%), Postives = 75/137 (54.74%), Query Frame = 3
Query:  213 WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEI-LKIRTTPRPTVAGPKDTPVDLVMEKTY 620
            W ++RGD V ++ GK+KG+ G + +VIR++N VI+EG N                   EAP+   ++ ++DP   KP ++  +Y E+G +VRV+     +G IIP+P    K    P+    GPKDT  +  ++KTY
Sbjct:   54 WPVVRGDTVEVLSGKEKGKQGKVAQVIRARNWVILEGLNTHYRYVGRSGDYRGTYLASEAPLLLKDIALIDPTDRKPTEIQWRYTEEGERVRVS---VRTGRIIPKPVFQRKDGIVPQQWKDGPKDTSPEDTLQKTY 187          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_RUBXD (50S ribosomal protein L24 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplX PE=3 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 4.626e-16
Identity = 41/97 (42.27%), Postives = 61/97 (62.89%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIG 506
            KI RGD V++I G++KG+ G ++RV+  +NRV+V+G N                +  +APIH SNV ++DP TG+P +VG ++ E G KVRVA+  G
Sbjct:    4 KIKRGDTVVVISGREKGKRGEVERVLPRENRVVVKGVNTRTRHARPSQQNPDGLYRFDAPIHISNVMLVDPNTGEPTRVGYRFTESGQKVRVAKRSG 100          
BLAST of FC930165 vs. ExPASy Swiss-Prot
Match: RL24_MESSB (50S ribosomal protein L24 OS=Mesorhizobium sp. (strain BNC1) GN=rplX PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 6.041e-16
Identity = 42/97 (43.30%), Postives = 58/97 (59.79%), Query Frame = 3
Query:  216 KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIG 506
            KI +GD V+++ G+DKG TG + +++  ++R +V G NLV               T EAPIH SN+ + DP  GKP +VG K  EDG KVRVA+  G
Sbjct:    3 KIKKGDKVVVLSGRDKGRTGEVLKMMPKEDRALVRGVNLVRRHQKQTPQAEGGIITKEAPIHVSNLALADPKDGKPTRVGFKIQEDGKKVRVAKRSG 99          
The following BLAST results are available for this feature:
BLAST of FC930165 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 211
Match NameE-valueIdentityDescription
RM24_BOVIN9.320e-1736.5039S ribosomal protein L24, mitochondrial OS=Bos ta... [more]
RL24_RICPR1.590e-1645.6350S ribosomal protein L24 OS=Rickettsia prowazekii... [more]
RL24_RHOCS2.076e-1646.6050S ribosomal protein L24 OS=Rhodospirillum centen... [more]
RM24_XENLA2.712e-1634.78Probable 39S ribosomal protein L24, mitochondrial ... [more]
RL24_RICTY2.712e-1644.6650S ribosomal protein L24 OS=Rickettsia typhi GN=r... [more]
RL24_RICFE3.542e-1645.6350S ribosomal protein L24 OS=Rickettsia felis GN=r... [more]
RL24_FRASN3.542e-1644.1250S ribosomal protein L24 OS=Frankia sp. (strain E... [more]
RM24_DANRE4.626e-1634.31Probable 39S ribosomal protein L24, mitochondrial ... [more]
RL24_RUBXD4.626e-1642.2750S ribosomal protein L24 OS=Rubrobacter xylanophi... [more]
RL24_MESSB6.041e-1643.3050S ribosomal protein L24 OS=Mesorhizobium sp. (st... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004E02EF PostHarvC1 Citrus clementina cDNA clone C34004E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930165 ID=FC930165; Name=FC930165; organism=Citrus clementina; type=EST; length=778bp
ATGAAAATGGTCAAACGAGACAACTCTTGGAAGGCCTGCCCAGAGTCGTA
ACGCCTTCTCTCTCTATATCGGCAAAAACCCTAAACCCGGAAACTCTGCA
AGCTCAGGGCTCTTTACTCCGTCGGTGACACGTGCAGGTACTTCTCTAAG
AATACTGATCTCTTTCTAAGTTTGAAATGGGCTGGAAAGCTGCCGAGAAA
CTCATCAGGCACTGGAAAATACTCAGAGGAGATAATGTTATGATCATTAG
GGGTAAGGATAAAGGCGAAACTGGTGCTATTAAGCGTGTCATTCGATCTC
AAAACCGAGTCATTGTCGAGGGGAAAAATCTGGTAAAAAAGCATATCAAG
GGAGGAGAAGGTCATGAAGGTGGAATCTTTACAGTTGAAGCCCCAATTCA
TGCTTCAAATGTTCAAGTTCTTGATCCCGTTACGGGGAAGCCTTGTAAGG
TTGGAACTAAATATCTAGAAGACGGAACTAAAGTAAGAGTAGCTAGAGGT
ATAGGAGCATCTGGGTCCATAATTCCTCGTCCTGAGATCTTGAAGATAAG
GACAACACCAAGACCTACAGTTGCTGGTCCCAAGGATACTCCAGTGGATC
TTGTGATGGAGAAGACATACGATGCTAAAAGTGGAAAGGGCATGCCGGAT
CTTTAAAGAACCGTGTTCAATTTATTGAGATCTTATTATATAATGGGAGA
ATGTGGAGAAGAATGAGTGAGCGAATATGTATGCCTAGGATCAGTAATGA
TTTTGTATCCGTATCCTATATTTCAATC
back to top