FC930167

Overview
NameFC930167
Unique NameFC930167
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP16_ARATH (Putative clathrin assembly protein At4g40080 OS=Arabidopsis thaliana GN=At4g40080 PE=2 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 1.804e-69
Identity = 136/233 (58.37%), Postives = 166/233 (71.24%), Query Frame = 1
Query:   22 MGRL---ANLMGIIKDKVSQSKAAIIS---KPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGFFLXXXXXXVEMDKEEEKVSALVNIXXXXXXXXXXXXXXQMCKTPDCLHVRGNPLVDDIMGLVGEDYLS 702
            MGR+   A+L+G IKDK SQSKAA++S   K KTL+ HLS+LRATTHDPSTPP  + L  +LS G  SRATA++ +E++M+RL TT DA VA+KSLI +HHIVKHG FILQDQLSV+P++GGRNYLKLS FRD  +PL WELSSWVRWYALYLEHLLSTSR++GFF+      +  ++ EE VS+L N               + CK PD     G  L D I  LVGEDY+S
Sbjct:    1 MGRITSFADLIGRIKDKASQSKAALVSSNTKSKTLSFHLSVLRATTHDPSTPPGNRHLAVILSAGTGSRATASSAVESIMERLHTTGDACVALKSLIIIHHIVKHGRFILQDQLSVFPASGGRNYLKLSAFRDEKSPLMWELSSWVRWYALYLEHLLSTSRIMGFFISSTSSTIHKEEYEEMVSSLTNSDLLREIDALVGLLEEACKIPDLPFSGGKSLADKITQLVGEDYVS 233          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP17_ARATH (Putative clathrin assembly protein At5g10410 OS=Arabidopsis thaliana GN=At5g10410 PE=2 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 2.309e-24
Identity = 74/228 (32.46%), Postives = 115/228 (50.44%), Query Frame = 1
Query:   25 GRLANLMGIIKDKVSQSKAAII---SKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAG-GRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGFFLXXXXXXVEMDKEEEKVSALVNIXXXXXXXXXXXXXXQMCKTPDCLHVRGNPLVDDIMGLVGEDY 696
            G   +++G  KDK S  KA ++          +HL+LL++TT  P+ PP+   ++ ++S+ +S  A AA    A + RL+ T +A VA KSLI +H ++K            +   G GRN LKL+ F D ++ LT ELS W+RWY  YL+ L    +VLG F        +  +E+++VS+                   +C  P+   +  N +VD+I  LV EDY
Sbjct:    3 GLKTHIIGKFKDKASIGKARLVHSFGSTAVKYIHLALLKSTTRTPNKPPNSDYVSAVISYSNSRYAPAA--FSAALWRLRVTKNAIVATKSLIVIHKLIKSSR-------DKFEGLGHGRNNLKLNEFSDKSSNLTLELSQWIRWYGQYLDRLSWVPKVLGSFPNLLVNPKDKVEEKDRVSSYQTGYIIRQTDSLVSFFEHICTRPEIPPMFQNKIVDEIRELVIEDY 221          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP18_ARATH (Putative clathrin assembly protein At5g65370 OS=Arabidopsis thaliana GN=At5g65370 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.814e-19
Identity = 73/239 (30.54%), Postives = 117/239 (48.95%), Query Frame = 1
Query:   22 MGRLANLMGIIKDKVSQSKAAII---SKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVK-----HGSFILQDQLS----VYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGFFLXXXXXXVEMDKEEEKVSALVNIXXXXXXXXXXXXXXQMCKTPDCLHVRGNPLVDDIMGLVGEDYLS 702
            MG+LA L GI+KD+ SQ K  ++   S     T+ L+LL+AT+H  + PP  K +T L S            ++A++ RL+ T D  VA K LI +H +VK     +G   L++ ++    +Y + GG N LKL++   N++  T EL+ WV+WY  YL+  LS + VLG          +   E ++VS+                   +   P     + N +V ++  L+ +DY S
Sbjct:    1 MGKLATLNGILKDEASQMKLNVVHLCSSVNAKTIDLALLKATSHTSNNPPSDKYVTFLQST--IDTCYGPDTVDAILHRLRVTTDVCVAAKCLILLHKMVKSESGYNGEDSLRNNINHRTLIY-TQGGSN-LKLNDLNVNSSRFTRELTPWVQWYKQYLDCYLSIAEVLGITPNIKEKNEDKRLETQRVSSYPMDCILKQIDFLVELFEHISDRPKAPQSKLNKIVIEMTELMVQDYFS 235          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP6_ARATH (Putative clathrin assembly protein At4g25940 OS=Arabidopsis thaliana GN=At4g25940 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.733e-17
Identity = 57/154 (37.01%), Postives = 88/154 (57.14%), Query Frame = 1
Query:   43 MGIIKDKVSQSKAAIISKPKTLTLHLSLLRATTHDPSTPPDP--KRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGF 498
            +G IKD  + S A + S+ K L +  ++++AT H  S P +   +R+ +  S     RA  A  I AL  RL  T +  VAIK LI +H  ++ G    +++L  Y   G  + L++SNF+D+T+PL W+ S+W+R YAL+LE  L   RVL +
Sbjct:   11 VGAIKDSTTVSIAKVNSEFKDLDV--AIVKATNHVESAPKERHIRRIFSATSVVQP-RADVAYCIHALAKRLSKTRNWVVAIKVLIVIHRTLREGDPTFREELLNYSHRG--HILRISNFKDDTSPLAWDCSAWIRTYALFLEERLECYRVLKY 159          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP7_ARATH (Putative clathrin assembly protein At5g57200 OS=Arabidopsis thaliana GN=At5g57200 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.772e-16
Identity = 55/153 (35.95%), Postives = 85/153 (55.56%), Query Frame = 1
Query:   46 GIIKDKVSQSKAAIISKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGH--SSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGF 498
            G +KD  +   A + S+ K L +  ++++AT H  S PP  + +  + S       RA  A  I AL  RL  T +  VA+K LI +H  ++ G    +++L  Y     R+ L++SNF+D+T+PL W+ S+WVR YAL+LE  L   RVL +
Sbjct:   12 GALKDTTTVGLAKVNSEFKDLDI--AIVKATNHVES-PPKERHVRKIFSATSVIQPRADVAYCIHALSKRLSKTRNWVVAMKVLIVIHRTLREGDPTFREELLNYSHR--RHILRISNFKDDTSPLAWDCSAWVRTYALFLEERLECYRVLKY 159          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP8_ARATH (Putative clathrin assembly protein At2g01600 OS=Arabidopsis thaliana GN=At2g01600 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 1.148e-15
Identity = 51/153 (33.33%), Postives = 85/153 (55.56%), Query Frame = 1
Query:   46 GIIKDKVSQSKAAIISKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATA--AAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGF 498
            G +KD        + S+     L +++++AT H    PP  + L  + +    +RA A  A  I AL  RL  T + +VA+K+LI +H +++ G    +++L  +   G    L+LSNF+D+++P+ W+ S+WVR YAL+LE  L   RVL +
Sbjct:   12 GALKDSTKVGLVRVNSE--YADLDVAIVKATNH-VECPPKDRHLRKIFAATSVTRARADVAYCIHALSRRLHKTRNWTVALKTLIVIHRLLREGDPTFREELLNFSQRG--RILQLSNFKDDSSPIAWDCSAWVRTYALFLEERLECFRVLKY 159          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP9_ARATH (Putative clathrin assembly protein At1g14910 OS=Arabidopsis thaliana GN=At1g14910 PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 2.166e-14
Identity = 44/130 (33.85%), Postives = 74/130 (56.92%), Query Frame = 1
Query:  112 LHLSLLRATTHDPSTPPDPK-RLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGF 498
            L +++++AT H    P D   R   L +     RA  A  I AL  RL  T + +VA+K+L+ +H +++ G    +++L  +   G    +++SNF+D+++P+ W+ S WVR YAL+LE  L   RVL +
Sbjct:   32 LDVAIVKATNHVECPPKDRHLRKIFLATSAIRPRADVAYCIHALSRRLHKTRNWTVALKALLVIHRLLRDGDPTFREELLNFSQKG--RIMQISNFKDDSSPVAWDCSGWVRTYALFLEERLECFRVLKY 159          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP10_ARATH (Putative clathrin assembly protein At5g35200 OS=Arabidopsis thaliana GN=At5g35200 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.825e-14
Identity = 53/159 (33.33%), Postives = 84/159 (52.83%), Query Frame = 1
Query:   31 LANLMGIIKDKVSQSKAAIISKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSS---RATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLLSTSRVLGF 498
            L   +G IKD  + S A + S  K L +  ++++AT H     P  +R    +    S+   RA  A  I AL  RL  TH+ +VA+K+LI +H  ++       +++  Y S    + L +S+F+D++ P  W  S+WVR+YAL+LE  L   RVL +
Sbjct:   11 LRRYLGAIKDTTTVSLAKVNSDYKELDI--AIVKATNHVER--PSKERYIRAIFMAISATRPRADVAYCIHALARRLSRTHNWAVALKTLIVIHRALREVDQTFHEEVINY-SRSRSHMLNMSHFKDDSGPNAWAYSAWVRFYALFLEERLECFRVLKY 164          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP1_ARATH (Probable clathrin assembly protein At4g32285 OS=Arabidopsis thaliana GN=At4g32285 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.302e-14
Identity = 46/144 (31.94%), Postives = 81/144 (56.25%), Query Frame = 1
Query:   43 MGIIKDKVSQSKAAIISKPKTLTLHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLL 474
            +G++KD+ S   A + S      L +++++AT+HD     D K +  +LS    SR    A + ++  RL+ T D  VA+K+L+ VH ++  G  + Q+++ +Y +  G   L +S+FRD     +W+ S++VR YA YL+  L
Sbjct:    9 IGVVKDQTSIGIAKVASNMAP-DLEVAIVKATSHDDDQSSD-KYIREILSLTSLSRGYVHACVTSVSRRLKKTRDWIVALKALMLVHRLLNEGDPLFQEEI-LYATRRGTRILNMSDFRDEAHSSSWDHSAFVRTYASYLDQRL 149          
BLAST of FC930167 vs. ExPASy Swiss-Prot
Match: CAP3_ARATH (Putative clathrin assembly protein At4g02650 OS=Arabidopsis thaliana GN=At4g02650 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 1.404e-13
Identity = 47/154 (30.52%), Postives = 83/154 (53.90%), Query Frame = 1
Query:   16 MNMGRLANLMGIIKDKVSQSKAAIISKPKTLT-LHLSLLRATTHDPSTPPDPKRLTTLLSFGHSSRATAAAVIEALMDRLQTTHDASVAIKSLIAVHHIVKHGSFILQDQLSVYPSAGGRNYLKLSNFRDNTTPLTWELSSWVRWYALYLEHLL 474
            M   +L   +G +KD+ S   A +  +  +LT L +++++AT HD   P + K +  +L     SR   +A +  L  RL  T + SVA+K+LI +  ++  G    + ++  + +  G   L +S+FRD +   +W+ S++VR YALYL+  L
Sbjct:    1 MGSSKLKRAIGAVKDQTSVGLAKVGGRSSSLTELEIAVVKATRHD-DYPAEDKYIREILCLTSYSRNYVSACVATLSRRLNKTKNWSVALKTLILIQRLLTDGDRAYEQEI-FFATRRGTRLLNMSDFRDASQSDSWDYSAFVRTYALYLDERL 152          
The following BLAST results are available for this feature:
BLAST of FC930167 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CAP16_ARATH1.804e-6958.37Putative clathrin assembly protein At4g40080 OS=Ar... [more]
CAP17_ARATH2.309e-2432.46Putative clathrin assembly protein At5g10410 OS=Ar... [more]
CAP18_ARATH3.814e-1930.54Putative clathrin assembly protein At5g65370 OS=Ar... [more]
CAP6_ARATH2.733e-1737.01Putative clathrin assembly protein At4g25940 OS=Ar... [more]
CAP7_ARATH1.772e-1635.95Putative clathrin assembly protein At5g57200 OS=Ar... [more]
CAP8_ARATH1.148e-1533.33Putative clathrin assembly protein At2g01600 OS=Ar... [more]
CAP9_ARATH2.166e-1433.85Putative clathrin assembly protein At1g14910 OS=Ar... [more]
CAP10_ARATH4.825e-1433.33Putative clathrin assembly protein At5g35200 OS=Ar... [more]
CAP1_ARATH6.302e-1431.94Probable clathrin assembly protein At4g32285 OS=Ar... [more]
CAP3_ARATH1.404e-1330.52Putative clathrin assembly protein At4g02650 OS=Ar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004E04EF PostHarvC1 Citrus clementina cDNA clone C34004E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930167 ID=FC930167; Name=FC930167; organism=Citrus clementina; type=EST; length=704bp
GGTAGGTGGATCTTTATGAACATGGGGCGCCTGGCAAATCTAATGGGCAT
AATCAAAGACAAGGTGTCACAGAGCAAAGCAGCCATAATCTCCAAACCCA
AAACCCTAACTCTCCATCTATCTCTTCTACGAGCCACAACTCACGACCCT
TCCACGCCGCCCGATCCGAAACGCCTGACCACGCTCCTCAGCTTCGGCCA
TAGCTCTCGGGCCACGGCCGCCGCCGTCATCGAAGCCCTCATGGACCGCC
TTCAGACAACCCACGATGCATCCGTCGCCATCAAGTCCCTCATCGCCGTC
CATCACATCGTCAAACATGGAAGCTTCATTCTCCAAGATCAGCTCTCTGT
TTATCCCTCCGCCGGTGGAAGAAACTATCTTAAATTGTCAAACTTCAGAG
ACAACACGACGCCGCTTACTTGGGAACTCTCTTCGTGGGTCAGATGGTAC
GCTTTATATCTCGAACACCTCTTGTCCACTTCTAGGGTTTTGGGTTTCTT
CCTTTCTTCAAGTTCAAGTTCTGTGGAGATGGATAAAGAAGAAGAGAAGG
TGTCGGCGCTCGTGAACATTGATTTGCTCAAAGAGGTCGATTCCTTGCTG
AGTTTGCTTGAACAGATGTGTAAAACGCCTGATTGTTTGCACGTGCGCGG
CAACCCTTTGGTGGACGATATCATGGGATTGGTGGGCGAAGATTACTTGT
CTGC
back to top