FC930170

Overview
NameFC930170
Unique NameFC930170
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length679
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 6.717e-103
Identity = 191/199 (95.98%), Postives = 192/199 (96.48%), Query Frame = 3
Query:   81 MAAMTSTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            MAAM STAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARP  +LFNAVAAEDLIV
Sbjct:    1 MAAMASTAFAPSVSSTTNKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIV 199          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 5.016e-74
Identity = 138/177 (77.97%), Postives = 155/177 (87.57%), Query Frame = 3
Query:  147 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            SSF+G P++PS +R+QP K+    ++S+S + SPPYDL  F FDPIKESIVSREMTRRYM DMITYADTD    GAGS+GL C YELSKNP++Q+AIIEQSVSPGGGAWLGGQLFS MVVRKPAH+FLDELGI+YDEQDNYVVIKHAALFTSTIMSKLLARP  +LFNAVAAEDLIV
Sbjct:   20 SSFYGTPLAPSSIRVQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIV 195          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.366e-71
Identity = 142/200 (71.00%), Postives = 165/200 (82.50%), Query Frame = 3
Query:   81 MAAMTSTAFAPSVSSTT-NKLFDSSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            MAA+ ST    S+SST   +LFDSSFHG+ +S + + +      +P + S+ A+ +  YDLN F FDPIKESIVSREMTRRYMTDMITYA+TD    GAGSAGLS AYE+SKNPN+Q+AIIEQSVSPGGGAWLGGQLFSAM+VRKPAH+FLDE+G+ YDEQD YVV+KHAALFTSTIMSKLLARP  +LFNAVAAEDLIV
Sbjct:    1 MAAIASTL---SLSSTKPQRLFDSSFHGSAISAAPISI----GLKPRSFSVRATTAG-YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIV 192          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 7.260e-65
Identity = 132/197 (67.01%), Postives = 152/197 (77.16%), Query Frame = 3
Query:  120 SSTTNKLFDSSFHGAPMSPSLLRLQPIK----------SSRPNNLSISASAS-PPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            ++  + L  SSF G+ + P+  R  P             + P   S+S S+S PPYDL +F+F PIKESIVSREMTRRYMTDMITYADTD    GAGSAGLSCAYELSK+P + IAI+EQSVSPGGGAWLGGQLFSAMVVRKPAH+FLDELG+ YDE ++YVVIKHAALFTST+MS LLARP  +LFNAVA EDLIV
Sbjct:    3 TAAASSLLKSSFAGSRL-PAATRTTPASLVVATGPRGAGAGPICASMSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTSTVMSLLLARPNVKLFNAVAVEDLIV 198          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 9.481e-65
Identity = 129/195 (66.15%), Postives = 151/195 (77.44%), Query Frame = 3
Query:  120 SSTTNKLFDSSFHGAPMSPSLLRLQ---------PIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            ++  + L  SSF G+ + PS  R           P     P   SIS S +PPYDL +F+F PIKESIVSREMTRRYMTDMIT+ADTD    GAGSAGLSCAYELSK+P + +AI+EQSVSPGGGAWLGGQLFSAMVVR+PAH+FLDELG+ YDE ++YVV+KHAALFTST+MS+LLARP  +LFNAVA EDLIV
Sbjct:    3 TTAASSLLKSSFAGSRL-PSATRTTTPSSVAVATPRAGGGPIRASIS-SPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHAALFTSTVMSRLLARPNVKLFNAVAVEDLIV 195          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.681e-45
Identity = 91/150 (60.67%), Postives = 120/150 (80.00%), Query Frame = 3
Query:  234 ASASPPYDLN-TFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            + A P Y L+ +F F PI+ES VSR MTRRY +D+  YA++D    GAGSAGL+ AY + ++ P+++IAIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+G+ Y+++ +YVV+KHAALFTST+M++ LA P  +LFNA A EDLIV
Sbjct:   37 SKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYYIGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVKHAALFTSTVMARTLALPNVKLFNATAVEDLIV 186          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 177.948 bits (450), Expect = 4.141e-44
Identity = 90/137 (65.69%), Postives = 107/137 (78.10%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLI 674
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L K  P+++IAIIE SVSPGGGAWLGGQLFSAM++RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  P  +LFNA   EDLI
Sbjct:   44 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQMPNIKLFNATCVEDLI 180          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 1.574e-43
Identity = 90/139 (64.75%), Postives = 111/139 (79.86%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSK-NPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDE--QDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLI 674
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS AY L+K  P+++IAI+E SVSPGGGAWLGGQLFSAMV+R+PA +FL+ELG+ Y+E    NYVV+KHA+LFTST+MSK+L+ P  +LFNA A EDLI
Sbjct:   48 FKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARPDLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASLFTSTLMSKVLSFPNVKLFNATAVEDLI 186          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.055e-43
Identity = 90/137 (65.69%), Postives = 106/137 (77.37%), Query Frame = 3
Query:  267 FKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYELSKN-PNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLI 674
            FKF PI+ES VSR MTRRY  D+  YA++D    GAGS GLS  Y L K  P+++IAIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+G+ Y+++ NYVV+KHAALFTSTIMSK+L  P  +LFNA   EDLI
Sbjct:   48 FKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIVGAGSCGLSTRYILGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSKVLQLPNCKLFNATCVEDLI 184          
BLAST of FC930170 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.506e-43
Identity = 88/167 (52.69%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  189 LQPIKSSRPNNLSISASA---SPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDXXXXGAGSAGLSCAYEL-SKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPKRQLFNAVAAEDLIV 677
            + P+KS + +N +++  A    P  +L   KF PIKE  V R M RRY  DM   A +D    GAGSAGLSCAY L +  P+++I I+E +V+PGGG WLGGQL SAMV RKPA  FLD++G+ Y+++ N+VV+KHAALFTST++SK+LA P  ++FNA A EDLI+
Sbjct:   24 MDPLKSKQQSNATVNKPAFKPEPAVNLTPIKFAPIKEHQVQRAMVRRYFQDMEERAISDVIIVGAGSAGLSCAYALGTARPDLKITILESNVAPGGGCWLGGQLMSAMVCRKPADEFLDQVGVPYEDEGNFVVVKHAALFTSTVLSKVLAMPNVKMFNATACEDLII 190          
The following BLAST results are available for this feature:
BLAST of FC930170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 21
Match NameE-valueIdentityDescription
THI4_CITSI6.717e-10395.98Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL5.016e-7477.97Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH1.366e-7171.00Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE7.260e-6567.01Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE9.481e-6566.15Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI2_SCHPO1.681e-4560.67Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]
THI4_FUSOX4.141e-4465.69Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR1.574e-4364.75Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSSH2.055e-4365.69Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_UROFA3.506e-4352.69Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004E07EF PostHarvC1 Citrus clementina cDNA clone C34004E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930170 ID=FC930170; Name=FC930170; organism=Citrus clementina; type=EST; length=679bp
TCATCACTCCTGCAAATCAAATTACTTCTCATTATCAAACTTCTAAGCAG
CAGGGGAAGGAGGGGTTAAAAAAAAAAAACATGGCAGCCATGACTTCTAC
AGCTTTCGCTCCTTCAGTTTCGTCCACCACCAATAAGCTCTTTGACTCAT
CCTTTCATGGGGCTCCCATGTCACCTTCTCTTCTACGTCTTCAACCCATC
AAATCTTCTCGTCCCAACAACTTGTCCATTTCTGCTTCTGCTTCTCCTCC
TTATGACTTGAACACTTTCAAGTTTGACCCCATCAAAGAATCCATTGTTT
CTCGTGAAATGACACGCAGGTACATGACGGACATGATCACTTATGCTGAC
ACTGATGTGGTAGTGGTTGGTGCTGGCTCTGCTGGCCTCTCTTGTGCTTA
TGAGCTCAGCAAAAACCCCAACATTCAGATTGCTATTATCGAACAGTCTG
TTAGCCCCGGCGGTGGCGCGTGGCTCGGTGGACAGCTCTTCTCTGCCATG
GTTGTGCGCAAACCAGCCCACATCTTCCTTGACGAGCTTGGCATCGACTA
CGATGAGCAAGACAACTATGTTGTGATCAAGCATGCAGCGCTGTTCACCT
CCACTATAATGAGCAAGCTCCTGGCCCGCCCCAAACGTCAGCTCTTTAAT
GCAGTGGCAGCCGAGGACTTGATAGTCAA
back to top