FC930172

Overview
NameFC930172
Unique NameFC930172
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length672
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930172 vs. ExPASy Swiss-Prot
Match: CCS_RAT (Copper chaperone for superoxide dismutase OS=Rattus norvegicus GN=Ccs PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.903e-17
Identity = 55/131 (41.98%), Postives = 74/131 (56.49%), Query Frame = 3
Query:  279 TSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSIN 668
            +  GD G    L E+ V M C+ CVDAV + L+   GV+NVEV L NQ+V +  + P + +   LE TGR+A L G G  +   + AAVA  +G   V GVVR  Q++ EL  IE    GL PG HG  ++
Sbjct:    3 SKSGDGGTMCAL-EFTVQMSCQSCVDAVHKTLKGAAGVQNVEVQLENQMVLVQTTLPSQEVQALLESTGRQAVLKGMGSSQLKNLGAAVAIMEGSGTVQGVVRFLQLSSELCLIEGTIDGLEPGLHGLHVH 132          
BLAST of FC930172 vs. ExPASy Swiss-Prot
Match: CCS_MOUSE (Copper chaperone for superoxide dismutase OS=Mus musculus GN=Ccs PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.903e-17
Identity = 54/131 (41.22%), Postives = 75/131 (57.25%), Query Frame = 3
Query:  279 TSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKG-PDVFGVVRLAQVNMELARIEANFSGLSPGKHGWSIN 668
            +  GD G    L E+ V M C+ CVDAV + L+ V GV+NV+V L NQ+V +  + P + +   LE TGR+A L G G  +   + AAVA  +G   + GVVR  Q++ EL  IE    GL PG HG  ++
Sbjct:    3 SKSGDGGTVCAL-EFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQLENQMVLVQTTLPSQEVQALLESTGRQAVLKGMGSSQLQNLGAAVAILEGCGSIQGVVRFLQLSSELCLIEGTIDGLEPGLHGLHVH 132          
BLAST of FC930172 vs. ExPASy Swiss-Prot
Match: CCS_HUMAN (Copper chaperone for superoxide dismutase OS=Homo sapiens GN=CCS PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.443e-17
Identity = 55/131 (41.98%), Postives = 75/131 (57.25%), Query Frame = 3
Query:  279 TSQGDQGLPELLTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSIN 668
            +  G+QG    L E+ V M C+ CVDAV++ LQ V GV++VEV L +Q+V +  + P + +   LE TGR+A L G G  +   + AAVA   GP  V GVVR  Q+  E   IE    GL PG HG  ++
Sbjct:    3 SDSGNQGTLCTL-EFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVH 132          
BLAST of FC930172 vs. ExPASy Swiss-Prot
Match: CCS_PIG (Copper chaperone for superoxide dismutase OS=Sus scrofa GN=CCS PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.747e-16
Identity = 50/120 (41.67%), Postives = 67/120 (55.83%), Query Frame = 3
Query:  312 LTEYMVDMKCEGCVDAVKQKLQTVTGVKNVEVDLSNQVVRILGSSPLKTMTEALEQTGRKARLVGQGVPEDFLVSAAVAEFKGP-DVFGVVRLAQVNMELARIEANFSGLSPGKHGWSIN 668
            + E+ V M C+ CVDAV + LQ V G+++VEV L NQ+V +  + P + +   LE TGR+A L G G      + AAVA   G   V GVVR  Q+  E   IE    GL PG HG  ++
Sbjct:   13 MLEFAVQMTCQSCVDAVSRSLQGVAGIQSVEVQLENQMVLVQTTLPSQVVQALLEDTGRQAVLKGMGSGRWQNLEAAVAILGGSGPVQGVVRFLQLTPERCLIEGTIDGLKPGLHGLHVH 132          
The following BLAST results are available for this feature:
BLAST of FC930172 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
CCS_RAT1.903e-1741.98Copper chaperone for superoxide dismutase OS=Rattu... [more]
CCS_MOUSE1.903e-1741.22Copper chaperone for superoxide dismutase OS=Mus m... [more]
CCS_HUMAN9.443e-1741.98Copper chaperone for superoxide dismutase OS=Homo ... [more]
CCS_PIG2.747e-1641.67Copper chaperone for superoxide dismutase OS=Sus s... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34004E09EF PostHarvC1 Citrus clementina cDNA clone C34004E09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930172 ID=FC930172; Name=FC930172; organism=Citrus clementina; type=EST; length=672bp
GAAAAGACTTAATATAATAACTCGAAAAAATGGCTATTCTGAGGACAGTG
GCAACGTTAGCAACAGCCACAACAACAACAGCAGTAGCGGCCTTTGCCTT
CCCTTCTTCTTCTTCTTCTTTTTCGTCAAAATCTCATCAACCCAAATCCC
AAAATCTCTCCTTTTTCTCTTCACAATCTCTCTCACTTCTCTATTCAAAT
AAATCGCCTCTTGTCAAAAACTTCAGCAACCCACCTTCCGCTCTTCCCAT
GGACGCTTCCACATCTGATCACAAAGACACATCCCAGGGGGATCAGGGGT
TGCCTGAGCTTCTGACAGAATACATGGTGGACATGAAGTGTGAGGGTTGC
GTTGATGCCGTCAAGCAGAAGTTGCAGACTGTTACTGGAGTCAAGAATGT
TGAGGTGGACTTGAGCAATCAAGTTGTGAGAATTTTGGGATCTTCACCTC
TGAAGACCATGACCGAAGCTTTGGAGCAAACAGGACGAAAAGCCCGGTTA
GTTGGACAAGGGGTGCCTGAAGATTTTTTAGTCTCCGCTGCCGTTGCTGA
ATTCAAAGGTCCAGATGTATTTGGTGTGGTTCGCTTGGCTCAAGTGAATA
TGGAATTGGCTAGGATTGAAGCCAACTTTAGTGGGCTTTCACCTGGAAAA
CATGGCTGGTCTATTAATGATT
back to top