FC930182

Overview
NameFC930182
Unique NameFC930182
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length737
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR34_ARATH (Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2)

HSP 1 Score: 372.474 bits (955), Expect = 1.334e-102
Identity = 172/241 (71.37%), Postives = 205/241 (85.06%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKPPNSSS-NRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGRW 722
            R +GYWSN+SGLSVV PE LY++PPN+S+ N+ L  +I+PGE+T  PRGWVFPNNG PLRI VPNRVSY ++V+KDK+PPGV+GYCIDVFEAA+ LLPYPVP  YI+YG+GKRNP Y+++V +V  + FD AVGDITIVTNRT+ VDFTQP++ESGLVVVAPV++ KSSPW+FLKPFTI MW VTGGFFLFVGA+VWILEHRFN EFRGPP +QL+TIFWFSFST  FSH       LGR+
Sbjct:  436 RTVGYWSNHSGLSVVHPETLYSRPPNTSTANQRLKGIIYPGEVTKPPRGWVFPNNGKPLRIGVPNRVSYTDYVSKDKNPPGVRGYCIDVFEAAIELLPYPVPRTYILYGDGKRNPSYDNLVNEVVADNFDVAVGDITIVTNRTRYVDFTQPFIESGLVVVAPVKEAKSSPWSFLKPFTIEMWAVTGGFFLFVGAMVWILEHRFNQEFRGPPRRQLITIFWFSFSTMFFSHRENTVSSLGRF 676          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR35_ARATH (Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=GLR3.5 PE=2 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 3.184e-96
Identity = 158/240 (65.83%), Postives = 195/240 (81.25%), Query Frame = 3
Query:    9 RIGYWSNYSGLSVVAPEILYTKPPNSSS-NRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGRW 722
            R+GYWSN++G SV  PE LY+KP N+S+ ++ L  +IWPGE+   PRGWVFP NG PL+I VPNRVSY  + +KDK+P GVKG+CID+FEAA+ LLPYPVP  YI+YG+GK+NP Y++++ +VA N FD AVGD+TI+TNRTK VDFTQP++ESGLVVVAPV+  KSSPW+FLKPFTI MW VTG  FLFVGAV+WILEHRFN EFRGPP +Q++T+FWFSFST  FSH       LGR+
Sbjct:  430 RVGYWSNHTGFSVAPPETLYSKPSNTSAKDQRLNEIIWPGEVIKPPRGWVFPENGKPLKIGVPNRVSYKNYASKDKNPLGVKGFCIDIFEAAIQLLPYPVPRTYILYGDGKKNPSYDNLISEVAANIFDVAVGDVTIITNRTKFVDFTQPFIESGLVVVAPVKGAKSSPWSFLKPFTIEMWAVTGALFLFVGAVIWILEHRFNEEFRGPPRRQIITVFWFSFSTMFFSHRENTVSTLGRF 669          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR32_ARATH (Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2)

HSP 1 Score: 318.931 bits (816), Expect = 1.751e-86
Identity = 151/240 (62.92%), Postives = 183/240 (76.25%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKPPN-SSSNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGR 719
            R+IGYWSN+SGLS++ PE LY K  N SSSN+HL +V WPG  + TPRGWVFPNNG  LRI VP+R S+ EFV++      V+GY IDVFEAAV L+ YPVPH ++++G+G +NP +N+ V  V +  FDA VGDI IVT RT++VDFTQPY+ESGLVVVAPV KL  +PWAFL+PFT PMW VT  FFL VG+V+WILEHR N+EFRGPP +Q+VTI WFSFST  FSH       LGR
Sbjct:  410 RQIGYWSNHSGLSIIPPESLYKKLSNRSSSNQHLNNVTWPGGTSETPRGWVFPNNGRRLRIGVPDRASFKEFVSRLDGSNKVQGYAIDVFEAAVKLISYPVPHEFVLFGDGLKNPNFNEFVNNVTIGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKLNDTPWAFLRPFTPPMWAVTAAFFLIVGSVIWILEHRINDEFRGPPRKQIVTILWFSFSTMFFSHRENTVSTLGR 649          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR31_ARATH (Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 3.901e-86
Identity = 152/241 (63.07%), Postives = 185/241 (76.76%), Query Frame = 3
Query:    9 RIGYWSNYSGLSVVAPEILYTKPPN-SSSNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAK-DKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALN-KFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGR 719
            +IGYWSNYSGLS+V PE  Y+KPPN SSSN+HL SV WPG  + TPRGW+F NNG  LRI VP+R S+ +FV++ + S   V+GYCIDVFEAAV LL YPVPH +I +G+G  NP YN++V +V     FDA VGDI IVT RT++VDFTQPY+ESGLVVVAPV +L  +PWAFL+PFT+PMW VT  FF+ VGA +WILEHR N+EFRGPP +Q++TI WF+FST  FSH       LGR
Sbjct:  409 QIGYWSNYSGLSIVPPESFYSKPPNRSSSNQHLNSVTWPGGTSVTPRGWIFRNNGRRLRIGVPDRASFKDFVSRVNGSSNKVQGYCIDVFEAAVKLLSYPVPHEFIFFGDGLTNPNYNELVNKVTTGVDFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTRLNENPWAFLRPFTLPMWAVTASFFVIVGAAIWILEHRINDEFRGPPRRQIITILWFTFSTMFFSHRETTVSTLGR 649          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR31_ORYSJ (Glutamate receptor 3.1 OS=Oryza sativa subsp. japonica GN=GLR3.1 PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 6.885e-83
Identity = 140/241 (58.09%), Postives = 182/241 (75.52%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKPPNSS-SNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGRW 722
            R +GYWSNYSGLSV++PE LY KP N +   + L+ VIWPGE    PRGWVFPNNG  ++I VP+RVSY +FV+ D     V+G CIDVF AA+NLL YPVP+ ++ +GN + NP Y++++ ++  + FDA VGD+TI+TNRTK+VDFTQPY+ SGLVV+  V++  S  WAFL+PFTI MW VTG FFL +G VVW+LEHR N+EFRGPP++QL+T+FWFSFST  F+H       LGR+
Sbjct:  411 RTVGYWSNYSGLSVISPETLYKKPANRTRETQKLHDVIWPGETINKPRGWVFPNNGNEIKIGVPDRVSYRQFVSVDSETGMVRGLCIDVFVAAINLLAYPVPYRFVPFGNNRENPSYSELINKIITDDFDAVVGDVTIITNRTKVVDFTQPYVSSGLVVLTSVKRQNSGGWAFLQPFTIKMWTVTGLFFLIIGTVVWMLEHRINDEFRGPPAKQLITVFWFSFSTLFFAHREDTRSTLGRF 651          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR33_ARATH (Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=GLR3.3 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 3.778e-81
Identity = 151/241 (62.66%), Postives = 173/241 (71.78%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKP-PNSSSNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGV-KGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGR 719
            R+IGYWSN+SGLS V PE+LYTK  PN S++  L  VIWPGE    PRGWVF NNG  L+I VP RVSY EFV++ +    + KG+CIDVF AAVNLLPY VP  +I YGNGK NP Y  +V+ +    FD  VGD+ IVTNRTK+VDFTQPY  SGLVVVAP +KL S  WAFL+PF   MW VTG  FLFVG VVWILEHR N+EFRGPP +Q VTI WFSFST  F+H       LGR
Sbjct:  408 RQIGYWSNHSGLSTVLPELLYTKEKPNMSTSPKLKHVIWPGETFTKPRGWVFSNNGKELKIGVPLRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVKFIPYGNGKENPSYTHMVEMITTGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFKKLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFSTMFFAHRENTVSTLGR 648          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR36_ARATH (Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=GLR3.6 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.489e-69
Identity = 131/237 (55.27%), Postives = 164/237 (69.20%), Query Frame = 3
Query:   12 IGYWSNYSGLSVVAPEILYTKPPNSSSNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGR 719
            IGYW N+SGLSV+  + +      S S + L+SV+WPG     PRGWVF NNG  LRI VPNR  + E V+  KS   + G+C+DVF AA+NLLPY VP   + +GNG  NP  +++V+ +    +DA VGDITI+T RTK+ DFTQPY+ESGLVVVAPV+KL SS  AFL+PFT  MWL+    FL VGAV+W LEH+ N+EFRGPP +Q++T FWFSFST  FSH       LGR
Sbjct:  406 IGYWFNHSGLSVMPADEMEN---TSFSGQKLHSVVWPGHSIKIPRGWVFSNNGRHLRIGVPNRYRFEEVVSV-KSNGMITGFCVDVFIAAINLLPYAVPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVRKLGSSAMAFLRPFTPQMWLIAAASFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWFSFSTLFFSHRETTTSNLGR 638          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR37_ARATH (Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=GLR3.7 PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 2.726e-55
Identity = 108/226 (47.79%), Postives = 147/226 (65.04%), Query Frame = 3
Query:   12 IGYWSNYSGLSVVAPEILYTKPPNSS-SNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDK-SPPGVKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTCF 683
            +G+WS   G SVVAP+  +++   S  S+  L  + WPG     PRGWV  ++  PL+I VP RVS+ EFV ++K S   ++G+CIDVF  A+  +PY VP+ +  +GNG  +P YN ++Q V    +DAAVGDI IV +R+KLVDF+QPY  +GLVVV P     ++ W FL+PFT  +W V    FL +  V+WILEHR N +FRGPP +QL T+  FSFST F
Sbjct:  403 VGFWSKNGGFSVVAPKTRHSQKKTSFVSDEKLGDITWPGGGREKPRGWVIADSADPLKIVVPRRVSFVEFVTEEKNSSHRIQGFCIDVFIEALKFVPYSVPYIFEPFGNGHSSPNYNHLIQMVTDGVYDAAVGDIAIVPSRSKLVDFSQPYASTGLVVVIPAND-DNATWIFLRPFTSRLWCVVLVSFLVIAVVIWILEHRINEDFRGPPRRQLSTMLLFSFSTLF 627          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.022e-50
Identity = 100/231 (43.29%), Postives = 142/231 (61.47%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKPPNSSSNRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSP----PGVKGYCIDVFEAAVNLLPYPVPHNYIMYG--NGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQ-KLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFST 677
            R IG+W+  +GL     +   +    S+   HL  +IWPGE  + P+GW  P NG  LRI VP R+ + + V   + P      VKG+CID FEA +  +PY V + +  +   NG+    +ND+V QV L +FDA VGD TI+ NR+  VDFT P+M+SG+ ++ P++ ++K   ++FLKP +I +WL T  FF  VG  VW LEHR N++FRGP + Q  TIFWF+FST
Sbjct:  397 RSIGFWTEGNGLVKKLDQEPRSIGTLSTWPDHLKHIIWPGEAVSVPKGWEIPTNGKKLRIGVPKRIGFTDLVKVTRDPITNSTVVKGFCIDFFEAVIQAMPYDVSYEFFPFEKPNGEPAGNHNDLVHQVYLGQFDAVVGDTTILANRSSFVDFTLPFMKSGVGLIVPLKDEVKRDKFSFLKPLSIELWLTTLVFFFLVGISVWTLEHRVNSDFRGPANYQASTIFWFAFST 627          
BLAST of FC930182 vs. ExPASy Swiss-Prot
Match: GLR27_ARATH (Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3)

HSP 1 Score: 189.504 bits (480), Expect = 1.602e-47
Identity = 102/246 (41.46%), Postives = 145/246 (58.94%), Query Frame = 3
Query:    6 RRIGYWSNYSGLSVVAPEILYTKPPNSSS--NRHLYSVIWPGEITATPRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPG----VKGYCIDVFEAAVNLLPYPVPHNYIMYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKLKSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTC-FSHTGRHCEFLGRW 722
            R IG W   +G       I+  K  N++S     L  VIWPG+    P+GW  P NG  LR+ +P +  + EFV     P        GYCI++FEA +  LPY V   YI + +   N  Y+++V QV    +DA VGD+TIV NR+  VDFT PY ESG+ ++ P++  K++ W FL+P+++ +W+ T  FF+F+G +VWILEHR N +FRGPP  Q+ T FWF+FST  F+H  +    L R+
Sbjct:  410 RIIGLWRPSNG-------IVNAKSKNTTSVLGERLGPVIWPGKSKDVPKGWQIPTNGKMLRVGIPVKKGFLEFVDAKIDPISNAMTPTGYCIEIFEAVLKKLPYSVIPKYIAFLSPDEN--YDEMVYQVYTGAYDAVVGDVTIVANRSLYVDFTLPYTESGVSMMVPLKDNKNT-WVFLRPWSLDLWVTTACFFVFIGFIVWILEHRVNTDFRGPPHHQIGTSFWFAFSTMNFAHREKVVSNLARF 645          
The following BLAST results are available for this feature:
BLAST of FC930182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
GLR34_ARATH1.334e-10271.37Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=... [more]
GLR35_ARATH3.184e-9665.83Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=... [more]
GLR32_ARATH1.751e-8662.92Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=... [more]
GLR31_ARATH3.901e-8663.07Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=... [more]
GLR31_ORYSJ6.885e-8358.09Glutamate receptor 3.1 OS=Oryza sativa subsp. japo... [more]
GLR33_ARATH3.778e-8162.66Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=... [more]
GLR36_ARATH1.489e-6955.27Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=... [more]
GLR37_ARATH2.726e-5547.79Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=... [more]
GLR22_ARATH2.022e-5043.29Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=... [more]
GLR27_ARATH1.602e-4741.46Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004F07EF PostHarvC1 Citrus clementina cDNA clone C34004F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930182 ID=FC930182; Name=FC930182; organism=Citrus clementina; type=EST; length=737bp
GGTCACGGAGGATTGGTTATTGGTCAAATTATTCTGGTCTCTCTGTTGTT
GCTCCAGAGATCTTATATACAAAGCCTCCTAATTCTTCCAGTAATCGACA
TCTTTACAGTGTAATATGGCCTGGTGAAATTACGGCAACACCTCGGGGAT
GGGTGTTCCCTAACAATGGGATGCCATTAAGAATTGCGGTGCCTAACCGA
GTAAGTTATAATGAATTTGTGGCTAAAGACAAGAGCCCTCCGGGGGTGAA
AGGGTACTGTATTGATGTATTTGAAGCAGCAGTAAACTTGCTTCCTTATC
CTGTCCCACACAACTATATAATGTATGGAAATGGGAAGAGAAACCCGATC
TACAATGACATTGTGCAACAGGTTGCCCTGAATAAATTTGATGCAGCTGT
TGGTGACATCACGATTGTTACAAATCGGACAAAGCTTGTGGATTTTACAC
AGCCTTACATGGAATCTGGTCTTGTTGTTGTTGCTCCAGTTCAAAAGTTA
AAGTCTAGTCCTTGGGCTTTTCTCAAGCCTTTTACTATACCAATGTGGCT
CGTCACTGGAGGCTTCTTTCTTTTCGTGGGAGCCGTTGTTTGGATTCTTG
AGCATCGGTTCAATAATGAATTCCGTGGTCCTCCTAGTCAGCAACTTGTA
ACTATCTTCTGGTTTAGTTTCTCAACATGTTTTTCTCACACAGGGAGACA
CTGTGAGTTCCTGGGAAGGTGGACTGATGTATGCTGT
back to top