FC930186

Overview
NameFC930186
Unique NameFC930186
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QORH_ARATH (Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 2.327e-66
Identity = 131/183 (71.58%), Postives = 146/183 (79.78%), Query Frame = 2
Query:  113 MAGKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKGQLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAKLGN 661
            MAGK LMHA+QYNSYGGGAA L+HV++ VPTP  +EV LKLEAT+LNPVDWK+QKG +RPFLPRKFPCIPATD            K FKAGDKVVA L++L   GGGLAEFAVA E  TV RP EV AAE + LPVAGLTA QALT  AG+KLDG+G++ NILVTAASGGVGHYAVQLAKL N
Sbjct:    1 MAGK-LMHALQYNSYGGGAAGLEHVQVPVPTPKSNEVCLKLEATSLNPVDWKIQKGMIRPFLPRKFPCIPATDVAGEVVEVGSGVKNFKAGDKVVAVLSHL--GGGGLAEFAVATEKLTVKRPQEVGAAEAAALPVAGLTALQALTNPAGLKLDGTGKKANILVTAASGGVGHYAVQLAKLAN 180          

HSP 2 Score: 23.0978 bits (48), Expect = 2.327e-66
Identity = 8/11 (72.73%), Postives = 10/11 (90.91%), Query Frame = 1
Query:  664 HVTASCGARTL 696
            HVTA+CGAR +
Sbjct:  182 HVTATCGARNI 192          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QORH_SPIOL (Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.626e-64
Identity = 124/183 (67.76%), Postives = 141/183 (77.05%), Query Frame = 2
Query:  113 MAGKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKGQLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAKLGN 661
            MA K LMHA+QY+ YGGG   LKHVE++VP P  DE+LLK+EA  LNP+DWK+QKG LRP LPRKFP IP TD              FK GDKVVA L++    GG LAE+AVAKE+ TV RPPEVSAAEG+ LPVA LTAHQALTQ A +KLDGSG++KNIL+TAASGGVGHYAVQLAKLGN
Sbjct:    1 MAAK-LMHAIQYSGYGGGTDALKHVEVAVPDPKSDELLLKIEAATLNPIDWKIQKGVLRPLLPRKFPTIPGTDVAGEVVQAGSAVNRFKTGDKVVAVLSH--ATGGALAEYAVAKENLTVARPPEVSAAEGAALPVAALTAHQALTQFANIKLDGSGERKNILITAASGGVGHYAVQLAKLGN 180          

HSP 2 Score: 24.2534 bits (51), Expect = 1.626e-64
Identity = 9/12 (75.00%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  664 HVTASCGARTLN 699
            HVTA+CGAR L+
Sbjct:  182 HVTATCGARNLD 193          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_BOVIN (Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 8.793e-16
Identity = 57/180 (31.67%), Postives = 91/180 (50.56%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKG--QLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM A++   +GG        +++VP P   +VL+K++A  +NPVD  ++ G   ++P L    P  P  D              FK GD+V        T  GG AE+A+A + +  T P ++   +G+ + +   TA++AL  SA VK       +++LV  ASGGVG  A Q+A+
Sbjct:    4 GQKLMRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNIKPLL----PYTPGFDVAGIIEAVGESVSAFKKGDRVFT----TRTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTAYRALLHSACVK-----PGESVLVHGASGGVGIAACQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_LAMGU (Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.341e-15
Identity = 55/178 (30.90%), Postives = 88/178 (49.44%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKGQLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM A++ + +GG        +++VP P + +VL+K++A  +NPVD  ++ G        + P  P  D              FK GD+V        T  GG AE+A+A + +    P E+   +G+ + V   TA++AL  SA  K       +++LV  ASGGVG  A Q+A+
Sbjct:    4 GQRLMRAIRVSEFGGPEVLKLQSDVAVPIPEEHQVLIKVQACGVNPVDTYIRSGTYS--RKPRLPYTPGLDVAGLIEAVGERVSAFKKGDRVFT----TSTVSGGYAEYALAADHTVYKLPGELDFQKGAAIGVPYFTAYRALLHSACAKAG-----ESVLVHGASGGVGLAACQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QORL_ARATH (Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.699e-15
Identity = 60/181 (33.15%), Postives = 86/181 (47.51%), Query Frame = 2
Query:  131 MHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKGQLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNG----GGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQ---SAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            M A  Y+ YGG         + VP   +D+VL+K+ A ALNPVD K ++G+ +       P +P  D            K  K GD+V A ++     G    G LAE+   +E     +P  +  A+ +GLP+A  TA + L +   SAG         K+ILV   +GGVG   +QLAK
Sbjct:   78 MKAWVYSDYGGVDVLKLESNIVVPEIKEDQVLIKVVAAALNPVDAKRRQGKFKA-TDSPLPTVPGYDVAGVVVKVGSAVKDLKEGDEVYANVSEKALEGPKQFGSLAEYTAVEEKLLALKPKNIDFAQAAGLPLAIETADEGLVRTEFSAG---------KSILVLNGAGGVGSLVIQLAK 248          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_HUMAN (Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.270e-14
Identity = 56/180 (31.11%), Postives = 89/180 (49.44%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKG--QLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM AV+   +GG        +++VP P   +VL+K+ A  +NPV+  ++ G    +P L    P  P +D              FK GD+V        T  GG AE+A+A + +    P ++   +G+ + +   TA++AL  SA VK       +++LV  ASGGVG  A Q+A+
Sbjct:    4 GQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLL----PYTPGSDVAGVIEAVGDNASAFKKGDRVFT----SSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAG-----ESVLVHGASGGVGLAACQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_PONAB (Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.829e-14
Identity = 55/180 (30.56%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKG--QLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM AV+   +GG        +++VP P   + L+K+ A  +NPV+  ++ G    +P L    P  P +D              FK GD+V        T  GG AE+A+A + +    P ++   +G+ + +   TA++AL  SA VK       +++LV  ASGGVG  A Q+A+
Sbjct:    4 GQKLMRAVRVFEFGGPEVLKLQSDIAVPIPKDHQALIKVHACGVNPVETYIRSGTYSRKPLL----PYTPGSDVAGVIEAVGGNASAFKKGDRVFT----SSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSAHVKAG-----ESVLVHGASGGVGLAACQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_PIG (Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.825e-14
Identity = 54/180 (30.00%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKG--QLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM A++   +GG        ++++P P  ++VL+K+ A  +NPVD  ++ G   ++P L    P  P  D              FK GD+V      + T  GG AE+A+A + +    P ++   +G+ + +   TA  AL  SA VK       + +L+  ASGGVG  A Q+A+
Sbjct:    4 GQKLMSAIRVFKFGGPEVMKLQSDVAIPIPKDNQVLIKVHACGVNPVDTYIRSGTHNMKPLL----PYTPGLDVAGIVEAVGEHVSSFKKGDRVFT----VSTLSGGYAEYALAADDTVYMLPEKLDFKQGAAIGIPYFTACLALLHSACVKAG-----EIVLIHGASGGVGIAACQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_RAT (Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.302e-14
Identity = 55/180 (30.56%), Postives = 87/180 (48.33%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKG--QLRPFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM A++   +GG        ++ VP P   +VL+K+ A  +NPV+  ++ G    +P L    P  P +D              FK GD+V  F     T  GG AEFA++ +++T   P  +   +G+ L +   TA +AL  SA  +       +++LV  ASGGVG    Q+A+
Sbjct:    4 GQKLMRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPAL----PYTPGSDVAGIIESVGDGVSAFKKGDRVFCF----STVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAG-----ESVLVHGASGGVGLATCQIAR 170          
BLAST of FC930186 vs. ExPASy Swiss-Prot
Match: QOR_CAVPO (Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.230e-14
Identity = 55/180 (30.56%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  119 GKPLMHAVQYNSYGGGAADLKHVELSVPTPSKDEVLLKLEATALNPVDWKVQKGQLR--PFLPRKFPCIPATDXXXXXXXXXXXXKIFKAGDKVVAFLNYLVTNGGGLAEFAVAKESSTVTRPPEVSAAEGSGLPVAGLTAHQALTQSAGVKLDGSGQQKNILVTAASGGVGHYAVQLAK 652
            G+ LM A++   +GG        +++VP P   +VL+K+ A  +NPV+  ++ G     P L    P  P TD              FK GD+V        T  GG AE+A+A + +    P ++   +G+ + +   TA +AL  SA  K       +++LV  ASGGVG  A Q+A+
Sbjct:    4 GQKLMRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLL----PYTPGTDVAGVVESIGNDVSAFKKGDRVFT----TSTISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSARAKAG-----ESVLVHGASGGVGLAACQIAR 170          
The following BLAST results are available for this feature:
BLAST of FC930186 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
QORH_ARATH2.327e-6671.58Putative quinone-oxidoreductase homolog, chloropla... [more]
QORH_SPIOL1.626e-6467.76Quinone-oxidoreductase homolog, chloroplastic OS=S... [more]
QOR_BOVIN8.793e-1631.67Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2[more]
QOR_LAMGU3.341e-1530.90Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE... [more]
QORL_ARATH5.699e-1533.15Quinone oxidoreductase-like protein At1g23740, chl... [more]
QOR_HUMAN1.270e-1431.11Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=... [more]
QOR_PONAB2.829e-1430.56Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=... [more]
QOR_PIG4.825e-1430.00Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 ... [more]
QOR_RAT6.302e-1430.56Quinone oxidoreductase OS=Rattus norvegicus GN=Cry... [more]
QOR_CAVPO8.230e-1430.56Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004F11EF PostHarvC1 Citrus clementina cDNA clone C34004F11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930186 ID=FC930186; Name=FC930186; organism=Citrus clementina; type=EST; length=703bp
GACACTGTCACTGCGTTACATACATATTATAATCGTATGCAGAGTGGTCT
CTTTGATTCTATCGATAGCACACTCGAAATCCCAGAAACGGCATCGTGTA
TTAGCTGTGAAAATGGCAGGAAAGCCTCTTATGCACGCGGTTCAGTATAA
TTCTTATGGTGGAGGAGCTGCTGATTTGAAGCATGTTGAACTGTCGGTTC
CTACCCCAAGCAAAGATGAGGTTTTGCTTAAACTTGAAGCAACCGCTCTA
AATCCGGTTGACTGGAAAGTCCAGAAGGGCCAGTTACGCCCTTTTTTGCC
TCGCAAGTTTCCTTGCATACCTGCAACTGATGTAGCAGGAGAGGTCGTAG
GGGTAGGATCAGAAGTTAAAATTTTCAAAGCTGGTGACAAAGTTGTAGCT
TTTCTTAACTACCTCGTAACTAATGGAGGTGGACTAGCTGAGTTTGCTGT
GGCTAAGGAGAGCTCGACAGTTACCAGGCCACCAGAGGTTTCAGCAGCTG
AAGGTTCTGGCTTACCTGTTGCTGGTCTCACTGCTCACCAGGCCCTTACT
CAATCTGCAGGTGTCAAGCTTGATGGAAGTGGGCAACAGAAAAACATTCT
AGTAACTGCTGCCTCAGGGGGTGTAGGTCACTATGCTGTTCAGTTGGCGA
AGCTTGGAAACCGCACGTGACTGCCTCTTGTGGGGCTCGCACATTGAATT
TGT
back to top