FC930189

Overview
NameFC930189
Unique NameFC930189
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: GOX_SPIOL (Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.736e-63
Identity = 122/214 (57.01%), Postives = 159/214 (74.30%), Query Frame = 1
Query:   82 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPP---LKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            E  N+NE++ +A+  LPKM YD+YA GAED+ TL EN  AF RI FRPRIL+DV+ ID++TTIL +KIS PI+IAPTA+ K+A+PEGE ATARAA++  TIM LS  ++S++EEVA++   +R +QLYV+K R++ A LV+RAER GFKA+ LTVDTPRLGRREADIKN+ + PP   LKN EG+   K+     S   +     +D SLSWKD
Sbjct:    2 EITNVNEYEAIAKQKLPKMVYDYYASGAEDQWTLAENRNAFSRILFRPRILIDVTNIDMTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLTLKNFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKD 215          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: GOX2_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 OS=Arabidopsis thaliana GN=At3g14420 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.196e-60
Identity = 117/214 (54.67%), Postives = 157/214 (73.36%), Query Frame = 1
Query:   82 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPP---LKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            E  N+ E+  +A+  LPKM YD+YA GAED+ TL+EN  AF RI FRPRIL+DVS+ID++TT+L +KIS PI++APTA+ K+A+P+GE ATARAA++  TIM LS  ++S++EEVA++   +R +QLYV+K R++   LV+RAER GFKA+ LTVDTPRLGRRE+DIKN+   PP   LKN EGL   K+     S   +     +D +LSWKD
Sbjct:    2 EITNVTEYDAIAKQKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKD 215          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: GOX1_ARATH (Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 OS=Arabidopsis thaliana GN=At3g14415 PE=1 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.322e-59
Identity = 115/214 (53.74%), Postives = 155/214 (72.43%), Query Frame = 1
Query:   82 EPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPP---LKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            E  N+ E+  +A+  LPKM YD+YA GAED+ TL+EN  AF RI FRPRIL+DV++ID++TT+L +KIS PI++APTA  K+A+P+GE ATARAA++  TIM LS  ++S++EEVA++   +R +QLYV+K R +   LV+RAE+ GFKA+ LTVDTPRLGRRE+DIKN+   PP   LKN EGL   K+     S   +     +D +LSWKD
Sbjct:    2 EITNVTEYDAIAKAKLPKMVYDYYASGAEDQWTLQENRNAFARILFRPRILIDVNKIDMATTVLGFKISMPIMVAPTAFQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRKVVEQLVRRAEKAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKD 215          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX1_HUMAN (Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.725e-41
Identity = 87/214 (40.65%), Postives = 138/214 (64.49%), Query Frame = 1
Query:   94 LNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVA-ASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPPLKNLEGLLSTKVSSDTGSNFEADA------HETMDASLSWKD 714
            +N++++ A+  LPK  YD+Y  GA DE TL +N+ AF R    PR+L +V+  DLST++L  ++S PI +  TA+ ++A+ +GE+AT RA  S  T M+LS  ++S+IEEVA A   A+R  QLY++K R++T  LV++AE+ G+KA+ +TVDTP LG R  D++N+   PP   ++   ++ +S     NF  D+       + +D S+SW+D
Sbjct:    8 INDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWED 221          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX_DICDI (Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.776e-39
Identity = 95/213 (44.60%), Postives = 133/213 (62.44%), Query Frame = 1
Query:   88 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAASSNAVRS-YQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITP---PLKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            V+++E  E A+  LPKM YD+YA G+ D+ TL EN  AF RI   PR LVDVS+++  T I    IS PI+IAP A+ ++A+  GE+ T  A+   NTIM LS  S++++E++++++N     +QLYVFK R ++  LV+RAE  G+ ALVLTVDTP LG+R AD KN    P    LK  E L+ + +  D G N        +D SL+W D
Sbjct:   32 VSVSELHEEAKRLLPKMAYDYYASGSNDQITLAENENAFSRIKLVPRSLVDVSKVNTKTRIFGRDISTPILIAPWAMQRMASQRGELDTVEASKEFNTIMTLSSLSTTSVEDLSSATNGNPGWFQLYVFKDRKVSEELVKRAESIGYSALVLTVDTPFLGKRTADFKNSFKLPNGLSLKIFEKLMLSNL--DGGLN--QYIATMIDPSLTWND 240          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX1_MOUSE (Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.195e-38
Identity = 88/216 (40.74%), Postives = 135/216 (62.50%), Query Frame = 1
Query:   88 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVA-ASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPP---LKNLEG---LLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            V ++++++  R  L K  YD+Y  GA D+ TL +N++AF R    PR+L +V+ IDLST++L  ++S PI +  TA+  +A+ +GE+AT RA  +  T M+LS  ++S+IEEVA A   A+R  QLY++K R+I+  +V+RAE+ G+KA+ +TVDTP LG R  D++N+   PP   +KN E      S K +    S       + +D SLSW D
Sbjct:    6 VCISDYEQHVRSVLQKSVYDYYRSGANDQETLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQRVSMPICVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQGYKAIFVTVDTPYLGNRIDDVRNRFKLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDD 221          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX2_BOVIN (Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.573e-36
Identity = 91/210 (43.33%), Postives = 129/210 (61.43%), Query Frame = 1
Query:   88 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPPLKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            V L +F+E AR  L K  +DF  GGA+D  T  EN+ AF +I  RPR L DVS++D+ TTI   +ISAPI IAPT  H+LA P+GE++TARAA + +   + S  +S ++E+ VAA+   +R +QLYV   R I   ++Q+ E  GFKALV+TVD P++G R  DI N++    +K L  LL    S + G+         +D S+ W+D
Sbjct:    4 VCLTDFREHAREHLSKSTWDFIEGGADDCCTRDENMAAFKKIRLRPRYLKDVSKVDMRTTIQGAEISAPICIAPTGFHRLAWPDGEMSTARAAQAASICYITSTYASCSLEDIVAAAPRGLRWFQLYVHPNRQINKQMIQKVESLGFKALVITVDVPKVGNRRNDITNQV--DLMKKL--LLKDLGSPEMGNVMPYFQMSPIDPSICWED 209          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: CYB2_HANAN (Cytochrome b2, mitochondrial OS=Hansenula anomala GN=CYB2 PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 1.923e-34
Identity = 85/214 (39.72%), Postives = 120/214 (56.07%), Query Frame = 1
Query:   79 AEPVNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEEVAAS--SNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPPLKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            ++ +NL++F+ +AR  LP     +Y   A+DE TL+EN  A+HRI F P+IL+DV  +D+ST     K SAP  I+ TAL KL +PEGEVA A+ A   + + ++S  +S + +E+A +      + YQLYV   R IT   V+ AE  G K L +TVD P LGRRE D+K K       +++G        D            +D SLSWKD
Sbjct:  185 SQMINLHDFETIARQILPPPALAYYCSAADDEVTLRENHNAYHRIFFNPKILIDVKDVDISTEFFGEKTSAPFYISATALAKLGHPEGEVAIAKGAGREDVVQMISTLASCSFDEIADARIPGQQQWYQLYVNADRSITEKAVRHAEERGMKGLFITVDAPSLGRREKDMKMKFEAD--SDVQG---DDEDIDRSQGASRALSSFIDPSLSWKD 393          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX2_RAT (Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 7.307e-34
Identity = 90/213 (42.25%), Postives = 121/213 (56.81%), Query Frame = 1
Query:   88 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPP---LKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            V L +F+  A+  L K  +DF  G A+D  T  EN+ AF RI  RPR L D+S++D  TTI   +ISAPI I+PTA H +A P+GE +TARAA   N   V+S  +S ++E+ VAA+    R +QLY+    D    +VQRAE  GFKALV+T+DTP LG R  D +N++       LK+L  L   K +     +F         AS  W D
Sbjct:    4 VCLADFKAHAQKQLSKTSWDFIEGEADDGITYSENIAAFKRIRLRPRYLRDMSKVDTRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNKQMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEANILLKDLRALKEEKPTQSVPVSFP-------KASFCWND 209          
BLAST of FC930189 vs. ExPASy Swiss-Prot
Match: HAOX2_HUMAN (Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.800e-32
Identity = 88/210 (41.90%), Postives = 117/210 (55.71%), Query Frame = 1
Query:   88 VNLNEFQELARLALPKMYYDFYAGGAEDEHTLKENVEAFHRITFRPRILVDVSRIDLSTTILDYKISAPIIIAPTALHKLANPEGEVATARAAASCNTIMVLSFTSSSTIEE-VAASSNAVRSYQLYVFKKRDITATLVQRAERNGFKALVLTVDTPRLGRREADIKNKMITPPLKNLEGLLSTKVSSDTGSNFEADAHETMDASLSWKD 714
            V L +FQ  AR  L K   DF  GGA+D  T  +N+ AF RI  RPR L DVS +D  TTI   +ISAPI IAPT  H L  P+GE++TARAA +     + S  +S ++E+ V A+   +R +QLYV     +   L+QR E  GFKALV+T+DTP  G R  DI+N++     +NL   L+   S   G+         +  SL W D
Sbjct:    4 VCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQLIQRVESLGFKALVITLDTPVCGNRRHDIRNQL----RRNL--TLTDLQSPKKGNAIPYFQMTPISTSLCWND 207          
The following BLAST results are available for this feature:
BLAST of FC930189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
GOX_SPIOL5.736e-6357.01Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia... [more]
GOX2_ARATH1.196e-6054.67Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 ... [more]
GOX1_ARATH1.322e-5953.74Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 ... [more]
HAOX1_HUMAN4.725e-4140.65Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1... [more]
HAOX_DICDI5.776e-3944.60Hydroxyacid oxidase OS=Dictyostelium discoideum GN... [more]
HAOX1_MOUSE2.195e-3840.74Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=2... [more]
HAOX2_BOVIN1.573e-3643.33Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 S... [more]
CYB2_HANAN1.923e-3439.72Cytochrome b2, mitochondrial OS=Hansenula anomala ... [more]
HAOX2_RAT7.307e-3442.25Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2... [more]
HAOX2_HUMAN1.800e-3241.90Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34004G02EF PostHarvC1 Citrus clementina cDNA clone C34004G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930189 ID=FC930189; Name=FC930189; organism=Citrus clementina; type=EST; length=715bp
GATCCAATCCTCGGTTTCTCCTCTTCATTCAGAGATTGTTTTTTTGGGGT
GTATTTAGGAATTAGGTTTCAAATGGCAGCTGAACCTGTTAATTTGAATG
AGTTCCAAGAATTGGCAAGGCTGGCCCTTCCAAAAATGTATTATGATTTC
TACGCTGGTGGAGCAGAAGATGAACATACCCTAAAAGAGAATGTGGAAGC
CTTTCATAGAATTACGTTTCGGCCAAGAATTCTTGTCGATGTCAGCAGAA
TAGATTTATCGACTACTATACTTGATTACAAAATCTCGGCTCCCATTATC
ATTGCTCCAACGGCTTTGCATAAGCTTGCAAACCCTGAAGGAGAGGTAGC
CACAGCCAGAGCAGCAGCTTCATGTAACACCATAATGGTTTTATCCTTCA
CATCTAGCAGCACCATAGAGGAGGTTGCGGCCAGCTCCAATGCTGTTCGC
TCCTATCAATTATATGTATTCAAGAAACGAGATATAACAGCTACTCTAGT
GCAGAGAGCTGAAAGGAATGGTTTTAAGGCTCTTGTCCTAACTGTTGATA
CTCCAAGACTTGGTAGAAGGGAGGCAGATATAAAGAACAAAATGATTACA
CCGCCGTTGAAGAATTTGGAAGGCCTCTTATCAACCAAAGTCAGCTCTGA
TACAGGTTCGAATTTTGAAGCTGATGCCCATGAGACCATGGATGCTTCTT
TAAGTTGGAAGGATT
back to top