FC930490

Overview
NameFC930490
Unique NameFC930490
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length739
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15282 contig Ccv1_Contig15282:5..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: CYPR1_CYNCA (Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 4.969e-57
Identity = 105/165 (63.64%), Postives = 125/165 (75.76%), Query Frame = 3
Query:  243 GVHHRLGDSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            GV     DSD +++ LKN+MDAQYFGEIGIG+PPQ F+VIFDTGSSNLWVPSSKCYFS++C FHS+Y+S  S TY + GKS  I YG+GSISGFFSQ              FIEAT+E  +TFL A+FDGI+GLGF+EI+VGDAVPVW  M+ QGL+   VFSFW
Sbjct:   28 GVRGNFRDSDGELIALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYRSTDSTTYKKNGKSAAIQYGTGSISGFFSQDSVKLGDLLVKEQDFIEATKEPGITFLAAKFDGILGLGFQEISVGDAVPVWYTMLNQGLVQEPVFSFW 192          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: ASPR1_ORYSJ (Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 1.107e-56
Identity = 109/184 (59.24%), Postives = 139/184 (75.54%), Query Frame = 3
Query:  192 AARITRKE--RYMGGAGVSGVHHRLGDSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            AAR++ +E  R +G  G + +    G  + DI+ LKN+M+AQYFGEIG+G+PPQ F+VIFDTGSSNLWVPS+KCYFSI+C+FHSRYKS +S+TY + GK   I YG+GSI+GFFS+              FIEAT+E  LTF++A+FDGI+GLGF+EI+VGDAVPVW  MVEQGL+   VFSFW
Sbjct:   45 AARLSGEEGARRLGLRGANSLGG--GGGEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQKNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQEISVGDAVPVWYKMVEQGLVSEPVFSFW 226          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: ASPR_HORVU (Phytepsin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.308e-54
Identity = 99/167 (59.28%), Postives = 127/167 (76.05%), Query Frame = 3
Query:  237 VSGVHHRLGDSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            +SG +    + + DI+ LKN+M+AQYFGEIG+G+PPQ F+VIFDTGSSNLWVPS+KCYFSI+CY HSRYK+  S+TY + GK   I YG+GSI+G+FS+              FIEAT+E  +TFL+A+FDGI+GLGF+EI+VG AVPVW  M+EQGL+   VFSFW
Sbjct:   59 LSGANPLRSEEEGDIVALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFW 225          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: ASPRX_ORYSJ (Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 2.552e-53
Identity = 104/208 (50.00%), Postives = 139/208 (66.83%), Query Frame = 3
Query:  114 LLLPASSNXXXXXXXXXXXXXXHSLNAARITRKERYMGGAGVSGVHHRLGDSDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            LLL ASS+                L AA++ ++   +          + G SD D +PL ++++ QY+G IG+GSPPQNF+VIFDTGSSNLWVPS+KCYFSI+CY HSRY S+KS++Y   G++C+I YGSG+ISGFFS+              FIEATRE S+TF++ +FDGI+GLG+ EI+VG A P+W +M EQ LL  +VFSFW
Sbjct:   20 LLLHASSDGFLRVNLNKKRLDKEDLTAAKLAQQGNRL---------LKTGSSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYNSKKSSSYKADGETCKITYGSGAISGFFSKDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGYPEISVGKAPPIWQSMQEQELLADDVFSFW 218          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: ASPR_CUCPE (Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.829e-51
Identity = 97/157 (61.78%), Postives = 122/157 (77.71%), Query Frame = 3
Query:  267 SDEDILPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            SD DI+ LKN++DAQY+GEI IG+PPQ F+VIFDTGSSNLWV   +C FS++C+FH+RYKS +S++Y + G S  I YG+G++SGFFS               FIEATRE SLTFL+A+FDG++GLGF+EIAVG+AVPVW NMVEQGL+   VFSFW
Sbjct:   75 SDTDIVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWV-LCECLFSVACHFHARYKSSRSSSYKKNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKEQVFIEATREPSLTFLVAKFDGLLGLGFQEIAVGNAVPVWYNMVEQGLVKEPVFSFW 230          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: NAPSA_MOUSE (Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.319e-38
Identity = 79/153 (51.63%), Postives = 102/153 (66.67%), Query Frame = 3
Query:  282 LPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKC-YFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            +PL  FM+ QYFG IG+G+PPQNF+V+FDTGSSNLWVPS++C +FS++C+FH R+  + S+++   G    I YG+G +SG  SQ              F EA  E SL F LA FDGI+GLGF  +AVG   P  D MVEQGLL + VFSF+
Sbjct:   63 VPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFY 215          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: CARP_NEUCR (Vacuolar protease A OS=Neurospora crassa GN=pep-4 PE=3 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 3.028e-38
Identity = 81/152 (53.29%), Postives = 101/152 (66.45%), Query Frame = 3
Query:  282 LPLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            +P+ NFM+AQYF EI IG+PPQ F V+ DTGSSNLWVPSS+C  SI+CY H++Y+S +S+TY + G S +I YGSGS+SGF SQ              F EAT E  L F   RFDGI+GLG+  IAV    P +  MVEQ L+   VFSF+
Sbjct:   75 VPITNFMNAQYFSEITIGTPPQTFKVVLDTGSSNLWVPSSQCG-SIACYLHNKYESSESSTYKKNGTSFKIEYGSGSLSGFVSQDRMTIGDITINDQLFAEATSEPGLAFAFGRFDGILGLGYDRIAVNGITPPFYKMVEQKLVDEPVFSFY 225          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: CATD_CHICK (Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.955e-38
Identity = 74/151 (49.01%), Postives = 103/151 (68.21%), Query Frame = 3
Query:  288 LKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYF-SISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            LKN+MDAQY+GEIGIG+PPQ F+V+FDTGSSNLWVPS  C+   I+C  H +Y + KS+TY E G    I+YG+GS+SGF SQ              F EA ++  +TF+ A+FDGI+G+ F  I+V    P +DN+++Q L+ + +FSF+
Sbjct:   70 LKNYMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSVHCHLLDIACLLHHKYDASKSSTYVENGTEFAIHYGTGSLSGFLSQDTVTLGNLKIKNQIFGEAVKQPGITFIAAKFDGILGMAFPRISVDKVTPFFDNVMQQKLIEKNIFSFY 220          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: ASPP_AEDAE (Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.963e-37
Identity = 75/152 (49.34%), Postives = 102/152 (67.11%), Query Frame = 3
Query:  285 PLKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFS-ISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQXXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            PL N++DAQY+G I IG+PPQ+F V+FDTGSSNLWVPS +C F+ I+C  H++Y ++KS+T+ + G +  I YGSGS+SG+ S               F EA  E  L F+ A+FDGI+GLG+  I+V   VPV+ NM  QGL+   VFSF+
Sbjct:   59 PLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLGYSSISVDGVVPVFYNMFNQGLIDAPVFSFY 210          
BLAST of FC930490 vs. ExPASy Swiss-Prot
Match: CATD_HUMAN (Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.373e-37
Identity = 76/162 (46.91%), Postives = 109/162 (67.28%), Query Frame = 3
Query:  288 LKNFMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKC-YFSISCYFHSRYKSRKSNTYTEIGKSCEINYGSGSISGFFSQ-----------XXXXXXXXXXXXXXFIEATREGSLTFLLARFDGIIGLGFREIAVGDAVPVWDNMVEQGLL*REVFSFW 737
            LKN+MDAQY+GEIGIG+PPQ F+V+FDTGSSNLWVPS  C    I+C+ H +Y S KS+TY + G S +I+YGSGS+SG+ SQ                         F EAT++  +TF+ A+FDGI+G+ +  I+V + +PV+DN+++Q L+ + +FSF+
Sbjct:   71 LKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFY 232          
The following BLAST results are available for this feature:
BLAST of FC930490 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 98
Match NameE-valueIdentityDescription
CYPR1_CYNCA4.969e-5763.64Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO... [more]
ASPR1_ORYSJ1.107e-5659.24Aspartic proteinase oryzasin-1 OS=Oryza sativa sub... [more]
ASPR_HORVU2.308e-5459.28Phytepsin OS=Hordeum vulgare PE=1 SV=1[more]
ASPRX_ORYSJ2.552e-5350.00Aspartic proteinase OS=Oryza sativa subsp. japonic... [more]
ASPR_CUCPE1.829e-5161.78Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1[more]
NAPSA_MOUSE2.319e-3851.63Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1[more]
CARP_NEUCR3.028e-3853.29Vacuolar protease A OS=Neurospora crassa GN=pep-4 ... [more]
CATD_CHICK3.955e-3849.01Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1[more]
ASPP_AEDAE1.963e-3749.34Lysosomal aspartic protease OS=Aedes aegypti GN=AA... [more]
CATD_HUMAN4.373e-3746.91Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34008B03EF PostHarvC1 Citrus clementina cDNA clone C34008B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930490 ID=FC930490; Name=FC930490; organism=Citrus clementina; type=EST; length=739bp
GGACATTATCTTCACTTTACCTTGCTTCAAACTCAGCTTCAGCAGAAAAC
CAAAGAACATCATGGAGCAGAAACTTCTTCGGTCAGTTTTCTGTTTATGG
GTGCTAGCGTCGTTTGCTTCTTCCTGCTTCCTCTAATGGCTTACGGAGAA
TTGGCTTGAAGAAGCGGCGTCTAGATCTTCATAGTCTAAATGCTGCAAGA
ATAACAAGAAAAGAGCGATATATGGGGGGAGCAGGTGTTAGTGGCGTGCA
CCATCGTTTGGGTGATTCAGATGAAGATATTTTGCCTTTGAAGAACTTTA
TGGATGCTCAATACTTTGGAGAGATTGGTATTGGCTCTCCCCCACAAAAT
TTCAGTGTCATATTTGATACCGGCAGTTCCAATCTCTGGGTTCCATCTTC
AAAGTGCTATTTCTCTATTTCCTGCTATTTCCATTCGAGGTACAAGTCCA
GAAAATCCAATACATATACCGAAATTGGAAAATCCTGTGAAATAAACTAT
GGATCTGGATCAATTTCTGGCTTCTTCAGTCAAGACAATGTTGAAGTTGG
GGATGTTGTTGTCAAGGATCAGGTTTTCATTGAGGCTACACGAGAAGGGA
GTCTCACTTTTCTATTGGCAAGGTTTGATGGAATAATAGGGCTTGGGTTC
CGGGAAATTGCAGTTGGGGATGCTGTGCCTGTGTGGGACAATATGGTTGA
GCAGGGCCTTTTGTAGCGAGAGGTCTTCTCATTCTGGCT
back to top