FC930501

Overview
NameFC930501
Unique NameFC930501
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length684
Libraries
Library NameType
PostHarvC1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC930501_ssr161 microsatellite FC930501_ssr161:161..172. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15160 contig Ccv1_Contig15160:1..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_CATRO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.201e-115
Identity = 207/227 (91.19%), Postives = 216/227 (95.15%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWLAFAAQKVVEVNALAKAL+G+KDEA+FS NAAAQASRKSSPRVTN+AVQKAAAAL+GSDHRRAT VSARLDAQQKKLNLP LPTTTIG FPQT++LRRVRRE+KAKKISEDDYVK IKEEI+ VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRP  MTVFWS  AQSMTKRPMKGMLTGPVTILNWSFVRNDQ
Sbjct:  348 KSWLAFAAQKVVEVNALAKALAGEKDEAFFSENAAAQASRKSSPRVTNQAVQKAAAALRGSDHRRATTVSARLDAQQKKLNLPVLPTTTIGSFPQTLELRRVRREYKAKKISEDDYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWSQTAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 574          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_ARATH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Arabidopsis thaliana GN=CIMS PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 3.495e-115
Identity = 206/227 (90.75%), Postives = 216/227 (95.15%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWLAFAAQKVVEVNALAKAL+GQKDEA FS+NAAA ASR+SSPRVTNE VQKAAAALKGSDHRRATNVSARLDAQQKKLNLP LPTTTIG FPQT++LRRVRRE+KAKK+SE+DYVK IKEEI  VV LQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPP+IYGDVSRPKAMTVFWS+MAQSMT RPMKGMLTGPVTILNWSFVRNDQ
Sbjct:  348 KSWLAFAAQKVVEVNALAKALAGQKDEALFSANAAALASRRSSPRVTNEGVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKVSEEDYVKAIKEEIKKVVDLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPVIYGDVSRPKAMTVFWSAMAQSMTSRPMKGMLTGPVTILNWSFVRNDQ 574          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_MESCR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 3.864e-114
Identity = 205/227 (90.31%), Postives = 216/227 (95.15%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWLAFAAQKV+EVNALAKALSGQKDEA+FS+NAAA ASRKSSPRVTNEAVQKAA ALKGSDHRRAT VS+RLDAQQKKLNLP LPTTTIG FPQT++LRRVRRE+KAKKISE++YVK IKEEI+ VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAF+ NGWVQSYGSRCVKPPIIYGDVSRP  MTVFWSSMAQSMT RPMKGMLTGPVTILNWSFVRNDQ
Sbjct:  348 KSWLAFAAQKVLEVNALAKALSGQKDEAFFSANAAALASRKSSPRVTNEAVQKAATALKGSDHRRATTVSSRLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREYKAKKISEEEYVKAIKEEISKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFSANGWVQSYGSRCVKPPIIYGDVSRPNPMTVFWSSMAQSMTARPMKGMLTGPVTILNWSFVRNDQ 574          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_SOLSC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Solenostemon scutellarioides GN=MET PE=1 SV=2)

HSP 1 Score: 407.527 bits (1046), Expect = 3.271e-113
Identity = 202/227 (88.99%), Postives = 214/227 (94.27%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWLAFAAQK+VEVNALAKAL+G KDEA+FS NAAAQASRKSSPRV NEAVQKAAAAL+GS+HRR TNVSARLDAQQKKLNLP LPTTTIG FPQT++LRRVRREFK  +ISE++YVK IKEEIN VVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFT NGWVQSYGSRCVKPPIIYGDVSRPK MTVFWS+ AQSMT+RPMKGMLTGPVTILNWSFVRNDQ
Sbjct:  347 KSWLAFAAQKIVEVNALAKALTGHKDEAFFSPNAAAQASRKSSPRVNNEAVQKAAAALRGSEHRRVTNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKPTRISEEEYVKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTQRPMKGMLTGPVTILNWSFVRNDQ 573          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_BURA4 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metE PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.390e-71
Identity = 136/229 (59.39%), Postives = 169/229 (73.80%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAY--FSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            +SWLAFA QK+ E+N LA AL+  +D+     ++NAAA  SR+ SPRV N AV+ A A +      RA+  + R   Q  +LNLP  PTTTIG FPQT D+R+ RR+FK+  + E  Y   ++ EI   V+ QE L++DVLVHGE ERNDMVEYFGEQL G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQ
Sbjct:  349 RSWLAFALQKLDELNVLATALNEGRDKVADALAANAAAIDSRRRSPRVNNPAVKAALARIDAQLGNRASPYTQRAPKQSARLNLPAFPTTTIGSFPQTADIRQARRQFKSGALDEAGYRAAMQAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQSLTNKPMKGMLTGPVTILNWSFVRDDQ 577          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_BORA1 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Bordetella avium (strain 197N) GN=metE PE=3 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 9.012e-71
Identity = 134/230 (58.26%), Postives = 173/230 (75.22%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAY---FSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWL+FA+QK+ E++ L +AL G   +A     ++  AA A+R+SSPR+ N AV +  AA +     RA   + R+  QQ +LNLP  PTTTIG FPQT ++R +RR++K+  +S+  Y   I++EI  V++ QE++ +DVLVHGEPERNDMVEYFGE L+GFAFT NGWVQSYGSRCVKPPII+GDV+RP  MTV WSS AQS+T +P+KGMLTGPVTIL WSFVR+DQ
Sbjct:  351 KSWLSFASQKLDELSLLGRALDGDSSQAVQEGLAAQRAALAARRSSPRIHNPAVGRRMAASEQVSRDRAP-FAERIRQQQARLNLPPFPTTTIGSFPQTAEIRGLRRDWKSGALSDSTYEALIRKEIEAVIRFQEKVGLDVLVHGEPERNDMVEYFGELLAGFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSSYAQSLTDKPVKGMLTGPVTILQWSFVRDDQ 579          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_BURCC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metE PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.622e-70
Identity = 134/229 (58.52%), Postives = 167/229 (72.93%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAY--FSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            +SWLAFA QK+ E+  LA AL+  +D+     ++NAAA  SR+ SPRV N AV+ A A +      R +  + R   Q  +LNLP  PTTTIG FPQT ++R+ R  FKA  + E  Y K ++ EI   V+ QE L++DVLVHGE ERNDMVEYFGEQL G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T++PMKGMLTGPVTILNWSFVR+DQ
Sbjct:  349 RSWLAFALQKLDELKVLATALNEGRDKVADALAANAAAIDSRRRSPRVNNPAVKAAIARIDARLGNRTSPYTQRASKQSARLNLPAFPTTTIGSFPQTAEIRQARSRFKAGALDEAGYRKAMQAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWIAYAQSLTRKPMKGMLTGPVTILNWSFVRDDQ 577          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_BURS3 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia sp. (strain 383) GN=metE PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.473e-70
Identity = 134/229 (58.52%), Postives = 167/229 (72.93%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAY--FSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            +SWLAFA QK+ E+  LA AL+  +D+     ++NAAA  SR+ SPRV N AV+ A A +      R +  + R   Q  +LNLP  PTTTIG FPQT ++R+ R +FKA  + E  Y K ++ EI   V+ QE L++DVLVHGE ERNDMVEYFGEQL G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQ
Sbjct:  349 RSWLAFALQKLDELKVLATALNEGRDKVADALAANAAAIHSRRHSPRVNNPAVKAAIARIDAQLGNRVSPYTQRAPKQSARLNLPAFPTTTIGSFPQTGEIRQARSQFKAGTLDEAGYRKAMQAEIERSVREQESLELDVLVHGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQSLTNKPMKGMLTGPVTILNWSFVRDDQ 577          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_BURCM (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metE PE=3 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 4.473e-70
Identity = 135/229 (58.95%), Postives = 165/229 (72.05%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQKDEAY--FSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            +SWLAFA QK+ E+  LA AL+  +D+     ++NAAA  SR+ SPRV N AV+ A A +      RA+  + R   Q  +LNLP  PTTTIG FPQT D+R  R +FKA  + E  Y   ++ EI   V+ QE L +DVLVHGE ERNDMVEYFGEQL G+AF+  GWVQSYGSRCVKPPI++GD+SRPKAMTV W + AQS+T +PMKGMLTGPVTILNWSFVR+DQ
Sbjct:  349 RSWLAFALQKLDELKVLATALNQGRDKVADALAANAAAIDSRRRSPRVNNPAVKAALARIDAQLGNRASPYTQRAPKQSARLNLPAFPTTTIGSFPQTADIRHARSQFKAGALDEAGYRAAMQAEIERSVREQESLGLDVLVHGEAERNDMVEYFGEQLDGYAFSQFGWVQSYGSRCVKPPILFGDISRPKAMTVEWITYAQSLTNKPMKGMLTGPVTILNWSFVRDDQ 577          
BLAST of FC930501 vs. ExPASy Swiss-Prot
Match: METE_CHRSD (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metE PE=3 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 5.841e-70
Identity = 135/230 (58.70%), Postives = 164/230 (71.30%), Query Frame = 2
Query:    2 KSWLAFAAQKVVEVNALAKALSGQ---KDEAYFSSNAAAQASRKSSPRVTNEAVQKAAAALKGSDHRRATNVSARLDAQQKKLNLPNLPTTTIGPFPQTMDLRRVRREFKAKKISEDDYVKTIKEEINNVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTVNGWVQSYGSRCVKPPIIYGDVSRPKAMTVFWSSMAQSMTKRPMKGMLTGPVTILNWSFVRNDQ 682
            KSWLAFA QK+ E+  LA  L G+   +D A   +  +A  +R+ SPR+   AV +  AA+   D  RA+  + R  AQ + L+LP  PTTTIG FPQT D+R  RR FK+ ++S DDY   +++EI + V+ QE L IDV VHGEPERNDMVEYFGE L GFAFT  GWVQSYGSRCVKPP+I+GDVSRP  MTV WS  AQS+T +PMKGMLTGPVTIL WSFVR+DQ
Sbjct:  345 KSWLAFARQKLDEIVTLAHLLDGRATPEDTARLEAATSALDARRQSPRIHKPAVGERLAAVSADDAERASPYATRAKAQHRHLDLPLFPTTTIGSFPQTQDIRAARRAFKSGELSRDDYEARMRDEIAHAVERQEALAIDVPVHGEPERNDMVEYFGELLDGFAFTRFGWVQSYGSRCVKPPVIFGDVSRPGPMTVRWSEYAQSLTDKPMKGMLTGPVTILQWSFVRDDQ 574          
The following BLAST results are available for this feature:
BLAST of FC930501 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 282
Match NameE-valueIdentityDescription
METE_CATRO1.201e-11591.195-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ARATH3.495e-11590.755-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_MESCR3.864e-11490.315-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SOLSC3.271e-11388.995-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURA41.390e-7159.395-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BORA19.012e-7158.265-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCC2.622e-7058.525-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURS34.473e-7058.525-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_BURCM4.473e-7058.955-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CHRSD5.841e-7058.705-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34008C02EF PostHarvC1 Citrus clementina cDNA clone C34008C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930501 ID=FC930501; Name=FC930501; organism=Citrus clementina; type=EST; length=684bp
CAAGTCCTGGCTTGCATTTGCTGCACAGAAAGTAGTTGAAGTAAATGCAT
TGGCCAAGGCATTGTCTGGGCAAAAGGATGAGGCATACTTCTCTTCTAAT
GCTGCAGCTCAGGCTTCAAGAAAATCCTCCCCAAGGGTGACAAATGAGGC
TGTCCAAAAGGCTGCTGCTGCTTTGAAGGGTTCTGACCATCGCCGAGCCA
CAAATGTCAGTGCTAGGCTGGATGCTCAGCAGAAGAAGTTGAACTTGCCA
AATCTTCCTACCACCACCATTGGACCTTTCCCACAAACGATGGATCTCCG
AAGAGTCCGACGTGAATTCAAGGCCAAGAAAATCTCTGAGGATGACTATG
TCAAGACTATCAAGGAGGAAATCAACAACGTTGTCAAGCTCCAGGAAGAA
CTTGACATTGATGTTTTGGTGCATGGAGAACCAGAGAGGAATGATATGGT
TGAGTACTTCGGTGAGCAATTATCTGGTTTTGCCTTCACTGTGAATGGGT
GGGTTCAATCTTATGGCTCCCGCTGTGTCAAGCCTCCTATCATCTATGGT
GATGTGAGCCGCCCCAAGGCCATGACTGTCTTCTGGTCTTCAATGGCACA
GAGTATGACCAAGCGACCAATGAAGGGAATGCTCACTGGCCCTGTCACCA
TTTTGAACTGGTCATTTGTTCGAAATGATCAGCC
back to top