FC930768

Overview
NameFC930768
Unique NameFC930768
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930768 vs. ExPASy Swiss-Prot
Match: GLYK_ARATH (D-glycerate 3-kinase, chloroplastic OS=Arabidopsis thaliana GN=GLYK PE=1 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.087e-40
Identity = 79/152 (51.97%), Postives = 103/152 (67.76%), Query Frame = 3
Query:  273 NPSHKFSHMPTHLSKSEALSAGTGCSWMQNNSMLQSGEGCPDLKQGLVCSAIPTERA-QVSSVQDLFAFICSGPLIDKMGFSKEKIGDSIDKWIAYNSYLCRLFQLNELYLTFPQKVRFFHYYIPVFLWCEESISQHVSKFKDGEDIPPFVM 725
            NPS  +        ++ +  A  GCSW+Q+NSM+       +      CSA+PT     VSSV DLF FICSGPL++K+G + +++G SIDKW+ Y S LCRLFQLNEL LT PQK R +HYYIPVF+WCE+ I+ H SKFKDG+D+PP V+
Sbjct:   61 NPSSSYLSSKLSPIRTHSSFAACGCSWIQDNSMVHDYATTTN-GTSKRCSALPTTNTVDVSSVSDLFEFICSGPLVNKIGITPQRVGQSIDKWLLYGSQLCRLFQLNELKLTIPQKARLYHYYIPVFIWCEDQIALHNSKFKDGDDVPPLVI 211          
The following BLAST results are available for this feature:
BLAST of FC930768 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GLYK_ARATH1.087e-4051.97D-glycerate 3-kinase, chloroplastic OS=Arabidopsis... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34108G12EF PostHarvP1 Citrus clementina cDNA clone C34108G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930768 ID=FC930768|Name=FC930768|organism=Citrus clementina|type=EST|length=728bp
GGAACTCATCACTCTTATGTGTCAAGCTATCCAAGAGGCACACACATAAG
CCAGAGAGAAGCAGAGAGGAAGAGATGAGCATGGCAACTTTGAATATCTT
ATTGCCAACTCCATCGACAAATTCTCATTATTTTAATGCTAATTATAGTC
AATCTTCTCATAATGTTTATTTTAATACTAATAATAATAGTAATAATAAT
ACTAAATTACACTCGTTGCCGTGCTCTCATTCTCTTCCTCTTCTTTCTTC
TCTCTTTGTGCAAACCAAATCAAACCCATCTCACAAATTCTCTCATATGC
CAACCCATTTGTCCAAATCAGAGGCTCTTTCTGCTGGAACTGGATGTTCA
TGGATGCAAAATAATTCCATGCTTCAAAGTGGTGAAGGTTGCCCTGATTT
GAAGCAGGGCCTAGTATGTTCAGCCATTCCCACGGAACGTGCTCAAGTTT
CATCTGTTCAGGACCTTTTCGCGTTTATATGCTCAGGTCCTCTCATAGAC
AAGATGGGCTTTTCCAAAGAAAAGATAGGCGACTCGATTGACAAGTGGAT
AGCGTACAACTCGTACTTGTGTCGGCTTTTTCAGCTCAATGAACTGTATC
TTACATTCCCACAGAAAGTAAGGTTTTTTCACTACTACATACCTGTTTTC
TTGTGGTGTGAAGAATCAATTTCTCAGCATGTGTCCAAGTTTAAGGATGG
AGAAGATATACCTCCCTTTGTGATGGTT
back to top