FC930769

Overview
NameFC930769
Unique NameFC930769
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length566
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig825 contig Ccv1_Contig825:203..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH_RICCO (Thioredoxin H-type OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 9.395e-43
Identity = 80/110 (72.73%), Postives = 94/110 (85.45%), Query Frame = 2
Query:   71 AEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            AEEGQVI CHTVE+WNEQLQKG   K LIVVDFTASWC PC+ ++P L+ELAKKLP V FLKVDVDELK+VA EWAVE+MPTF+  KEGK+++++VGAKKDELQ  + KH
Sbjct:    3 AEEGQVIGCHTVEAWNEQLQKGNDTKGLIVVDFTASWCGPCRFIAPFLAELAKKLPNVTFLKVDVDELKTVAHEWAVESMPTFMFLKEGKIMDKVVGAKKDELQQTIAKH 112          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH2_TOBAC (Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.357e-41
Identity = 79/111 (71.17%), Postives = 93/111 (83.78%), Query Frame = 2
Query:   68 MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            MAEEGQVI  HTV++WNE LQKGI  KKLIVVDFTASWC PCK ++   +ELAKK+P V FLKVDVDELKSVA +WAVEAMPTF+  KEGK+++++VGAKKDELQ  + KH
Sbjct:    1 MAEEGQVIGVHTVDAWNEHLQKGIDDKKLIVVDFTASWCGPCKFIASFYAELAKKMPTVTFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKH 111          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH1_ARATH (Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TRX1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.022e-41
Identity = 74/110 (67.27%), Postives = 94/110 (85.45%), Query Frame = 2
Query:   71 AEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            +EEGQVI+CHTVE+WNEQLQK   +K L+VVDFTASWC PC+ ++P  ++LAKKLP V+FLKVD DELKSVA +WA++AMPTF+  KEGK+L+++VGAKKDELQ  + KH
Sbjct:    3 SEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH 112          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH1_TOBAC (Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.444e-40
Identity = 72/110 (65.45%), Postives = 92/110 (83.64%), Query Frame = 2
Query:   71 AEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            +EEGQV  CH VE WNE  +KG+  KKL+VVDFTASWC PC+ ++PIL+++AKK+P VIFLKVDVDELK+V+ EW+VEAMPTFV  K+GK ++R+VGAKK+ELQ  + KH
Sbjct:    9 SEEGQVFGCHKVEEWNEYFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVSAEWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKH 118          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH_FAGES (Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.823e-36
Identity = 71/111 (63.96%), Postives = 89/111 (80.18%), Query Frame = 2
Query:   68 MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            MAEE QVI+CHTV+ WNE+ QK   + KLIV+DFTASWC PC++++P +SELAKK P V F KVDVD+LK VAEE+ VEAMP+FV+ KEG+ +ERIVGA+KDEL   +  H
Sbjct:    1 MAEEAQVIACHTVQEWNEKFQKAKDSGKLIVIDFTASWCGPCRVITPYVSELAKKFPHVAFFKVDVDDLKDVAEEYKVEAMPSFVILKEGQEVERIVGARKDELLHKIAVH 111          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH5_ARATH (Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TRX5 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.897e-35
Identity = 64/111 (57.66%), Postives = 90/111 (81.08%), Query Frame = 2
Query:   68 MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            MA EG+VI+CHT+E WNE+++    +KKLIV+DFTASWCPPC+ ++P+ +E+AKK   V+F K+DVDEL++VA+E+ VEAMPTFV  KEG +++R+VGA KDE+   + KH
Sbjct:    1 MAGEGEVIACHTLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKH 111          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH3_ARATH (Thioredoxin H-type 3 OS=Arabidopsis thaliana GN=TRX3 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.673e-34
Identity = 64/111 (57.66%), Postives = 88/111 (79.28%), Query Frame = 2
Query:   68 MAEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            MA EG+VI+CHTVE W E+L+    +KKLIV+DFTA+WCPPC+ ++P+ ++LAKK   V+F KVDVDEL +VAEE+ V+AMPTF+  KEG++ E +VGA K+E+   +EKH
Sbjct:    1 MAAEGEVIACHTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKH 111          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH4_ARATH (Thioredoxin H-type 4 OS=Arabidopsis thaliana GN=TRX4 PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 1.776e-33
Identity = 66/111 (59.46%), Postives = 88/111 (79.28%), Query Frame = 2
Query:   71 AEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKK-LPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            AEEGQVI CHT + W  QL K   + KLIV+DFTASWCPPC++++PI ++LAKK + + IF KVDVDEL+SVA+E+ VEAMPTFV  K G+V++++VGA K++LQ  + KH
Sbjct:    3 AEEGQVIGCHTNDVWTVQLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKH 113          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH_WHEAT (Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3)

HSP 1 Score: 141.739 bits (356), Expect = 2.319e-33
Identity = 64/107 (59.81%), Postives = 86/107 (80.37%), Query Frame = 2
Query:   80 GQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKKLPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            G+VIS H++E W  Q+++  AAKKL+V+DFTASWC PC++M+PI ++LAKK PA +FLKVDVDELK +AE+++VEAMPTF+  KEG V +R+VGA K+EL   V  H
Sbjct:   18 GEVISVHSLEQWTMQIEEANAAKKLVVIDFTASWCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFMKEGDVKDRVVGAIKEELTTKVGLH 124          
BLAST of FC930769 vs. ExPASy Swiss-Prot
Match: TRXH2_BRANA (Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.748e-33
Identity = 62/111 (55.86%), Postives = 88/111 (79.28%), Query Frame = 2
Query:   71 AEEGQVISCHTVESWNEQLQKGIAAKKLIVVDFTASWCPPCKLMSPILSELAKK-LPAVIFLKVDVDELKSVAEEWAVEAMPTFVLTKEGKVLERIVGAKKDELQLAVEKH 400
            AEEGQVI CH ++ W  QL     + KLIV+DFTASWCPPC++++P+ ++LAKK + + IF KVDVDEL++VA+E+ VEAMPTFVL K+G V++++VGA+K++L   + KH
Sbjct:    3 AEEGQVIGCHEIDVWAVQLDTAKQSNKLIVIDFTASWCPPCRMIAPVFADLAKKFMSSAIFFKVDVDELQNVAQEFGVEAMPTFVLIKDGNVVDKVVGARKEDLHATIAKH 113          
The following BLAST results are available for this feature:
BLAST of FC930769 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 103
Match NameE-valueIdentityDescription
TRXH_RICCO9.395e-4372.73Thioredoxin H-type OS=Ricinus communis PE=3 SV=1[more]
TRXH2_TOBAC1.357e-4171.17Thioredoxin H-type 2 OS=Nicotiana tabacum PE=3 SV=... [more]
TRXH1_ARATH3.022e-4167.27Thioredoxin H-type 1 OS=Arabidopsis thaliana GN=TR... [more]
TRXH1_TOBAC7.444e-4065.45Thioredoxin H-type 1 OS=Nicotiana tabacum PE=2 SV=... [more]
TRXH_FAGES3.823e-3663.96Thioredoxin H-type OS=Fagopyrum esculentum PE=3 SV... [more]
TRXH5_ARATH1.897e-3557.66Thioredoxin H-type 5 OS=Arabidopsis thaliana GN=TR... [more]
TRXH3_ARATH4.673e-3457.66Thioredoxin H-type 3 OS=Arabidopsis thaliana GN=TR... [more]
TRXH4_ARATH1.776e-3359.46Thioredoxin H-type 4 OS=Arabidopsis thaliana GN=TR... [more]
TRXH_WHEAT2.319e-3359.81Thioredoxin H-type OS=Triticum aestivum PE=1 SV=3[more]
TRXH2_BRANA6.748e-3355.86Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34108H01EF PostHarvP1 Citrus clementina cDNA clone C34108H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930769 ID=FC930769|Name=FC930769|organism=Citrus clementina|type=EST|length=566bp
GAAAACACAGAAACAAATATAAAGAAATCAGAACAGAGAAGTAATTTAAC
TTGTGATCATAATTAAGATGGCCGAGGAGGGACAAGTGATCAGCTGCCAC
ACTGTTGAATCCTGGAACGAGCAGCTCCAAAAGGGCATTGCGGCAAAGAA
ACTGATAGTGGTGGATTTTACGGCTTCATGGTGCCCGCCATGCAAGTTGA
TGTCTCCAATTTTGAGTGAATTGGCGAAGAAGCTGCCCGCTGTCATATTC
TTGAAGGTGGATGTTGATGAATTGAAGTCCGTCGCTGAGGAATGGGCTGT
GGAAGCCATGCCGACCTTTGTACTGACGAAAGAAGGCAAAGTCCTGGAGA
GGATTGTGGGAGCGAAGAAAGATGAGCTGCAGCTGGCTGTCGAAAAGCAC
GCAACAACTGTTGAGAATGCAACTACTGCTAATGCTTGATTGATGCGTAC
ATGAATCTCATTGGTCTTTTATTGTAAGGTGTGTGTTTGTGGTTGCTTAA
TGTAAGAATATGGTACCATGTTTAACAGGCCTGTATATACGAATAAATGA
CAATCTTCTAACAAAA
back to top