FC930771

Overview
NameFC930771
Unique NameFC930771
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC930771_ssr47 microsatellite FC930771_ssr47:47..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15376 contig Ccv1_Contig15376:39..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_ARATH (Translocon-associated protein subunit alpha OS=Arabidopsis thaliana GN=At2g21160 PE=2 SV=3)

HSP 1 Score: 235.728 bits (600), Expect = 1.748e-61
Identity = 121/196 (61.73%), Postives = 148/196 (75.51%), Query Frame = 2
Query:  125 QVARCQSDSETGVAETEGGDLGIVGEDAQDFG-------DGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVYEVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTLGIALLVLFGLWIHGQ 691
            QVARCQSD+E   +  +     +VGE+  D         D   S  PGV+TVC+FPKNSA++V AGEETELLVG+KN+G++ V V+ I+ASVHLP+DH LLVQNLT    NNA++P S QATFPYIFAVS++LQPG FDLVG I+Y+V+  PYQS FYNGTIEVVESGG +S ESVFL+TLGI LL+L GLW + Q
Sbjct:   20 QVARCQSDAEDHSSLVDD----VVGENTDDAVEEDDHDLDMNLSSFPGVETVCVFPKNSAKLVPAGEETELLVGLKNEGKTRVGVMGIRASVHLPYDHKLLVQNLTMLRLNNASIPTSLQATFPYIFAVSQYLQPGAFDLVGYIIYDVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLTLGIGLLLLLGLWAYSQ 211          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_DICDI (Translocon-associated protein subunit alpha OS=Dictyostelium discoideum GN=ssr1 PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 7.690e-17
Identity = 51/153 (33.33%), Postives = 80/153 (52.29%), Query Frame = 2
Query:  233 SPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVYEVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTLGIALLVLFGLWIHGQ 691
            +P   V    IFP N  +  AAG   E+LVG  N+ + ++N+  I AS++ P D S+ +QN T   F  A V     AT  Y F  S++L+P  F L+ S+ Y+     +  TF+N TI + E      ++S FL+ LG+  +   G  ++G+
Sbjct:   34 TPTSDVSFSYIFPDNQDKNFAAGSVVEVLVGFTNNADKALNITHIFASLNHPQDFSVFIQNYTRGDFGIA-VEKGHHATLAYRFVPSEYLEPREFGLLISLEYQDGAQNFTQTFFNSTINITEKETSFDMDSFFLILLGLGFVGGIGYIVYGK 185          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_RAT (Translocon-associated protein subunit alpha OS=Rattus norvegicus GN=Ssr1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.659e-11
Identity = 54/180 (30.00%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  146 DSETGVAETEGGDLGIVGEDAQDFGDGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVY-EVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTL--GIALLVLFGL 676
            D E  V E E  DL    E+ +D        +P  DT  +F K       A    + LVG  N G     V ++ AS   P D+   +QN T     N  VP   QATF Y F  ++ +    F LV ++ Y +++ + +Q   +N T+ V+E    +  E++F+     G+ LLV+ GL
Sbjct:   51 DDEAEVEEDEPTDLAEEKEEEEDVSSEP-EASPSADTTILFVKGED--FPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL-NTIVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVVVGL 226          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_PONAB (Translocon-associated protein subunit alpha OS=Pongo abelii GN=SSR1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.167e-11
Identity = 54/180 (30.00%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  146 DSETGVAETEGGDLGIVGEDAQDFGDGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVY-EVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTL--GIALLVLFGL 676
            D E  V E E  DL  V +  ++   G    +P  DT  +F K       A    + LVG  N G     V ++ AS   P D+   +QN T     N  VP   QATF Y F  ++ +    F LV ++ Y +++ + +Q   +N T+ V+E    +  E++F+     G+ LLV+ GL
Sbjct:   51 DDEAEVEEDEPTDL--VEDKEEEDVSGEPEASPSADTTILFVKGED--FPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL-NTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGL 225          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_HUMAN (Translocon-associated protein subunit alpha OS=Homo sapiens GN=SSR1 PE=1 SV=3)

HSP 1 Score: 69.3218 bits (168), Expect = 2.167e-11
Identity = 54/180 (30.00%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  146 DSETGVAETEGGDLGIVGEDAQDFGDGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVY-EVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTL--GIALLVLFGL 676
            D E  V E E  DL  V +  ++   G    +P  DT  +F K       A    + LVG  N G     V ++ AS   P D+   +QN T     N  VP   QATF Y F  ++ +    F LV ++ Y +++ + +Q   +N T+ V+E    +  E++F+     G+ LLV+ GL
Sbjct:   51 DDEAEVEEDEPTDL--VEDKEEEDVSGEPEASPSADTTILFVKGED--FPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL-NTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGL 225          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_CANFA (Translocon-associated protein subunit alpha OS=Canis familiaris GN=SSR1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.697e-11
Identity = 54/180 (30.00%), Postives = 83/180 (46.11%), Query Frame = 2
Query:  146 DSETGVAETEGGDLGIVGEDAQDFGDGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVY-EVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTL--GIALLVLFGL 676
            D E  V E E  DL    E+    G+   SP+   DT  +F K       A    + LVG  N G     V ++ AS   P D+   +QN T     N  VP   QATF Y F  ++ +    F LV ++ Y +++ + +Q   +N T+ ++E    +  E++F+     G+ LLV+ GL
Sbjct:   51 DDEAEVEEDEPTDLAEDKEEEDVSGEPEASPS--ADTTILFVKGED--FPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL-NTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTIIEREDGLDGETIFMYMFLAGLGLLVVVGL 225          
BLAST of FC930771 vs. ExPASy Swiss-Prot
Match: SSRA_BOVIN (Translocon-associated protein subunit alpha OS=Bos taurus GN=SSR1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.697e-11
Identity = 53/180 (29.44%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  146 DSETGVAETEGGDLGIVGEDAQDFGDGTFSPAPGVDTVCIFPKNSARVVAAGEETELLVGMKNDGESSVNVIAIQASVHLPFDHSLLVQNLTGQAFNNATVPVSAQATFPYIFAVSKFLQPGTFDLVGSIVY-EVDQHPYQSTFYNGTIEVVESGGFISIESVFLVTL--GIALLVLFGL 676
            D E  V E E  DL    +  +D   G    +P  DT  +F K       A    + LVG  N G     V ++ AS   P D+   +QN T     N  VP   QATF Y F  ++ +    F LV ++ Y +++ + +Q   +N T+ ++E    +  E++F+     G+ LLV+ GL
Sbjct:   51 DDEAEVEEDEPTDLA--EDKEEDDVSGEPEASPSADTTILFVKGED--FPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPL-NTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTIIEREDGLDGETIFMYMFLAGLGLLVVVGL 225          
The following BLAST results are available for this feature:
BLAST of FC930771 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
SSRA_ARATH1.748e-6161.73Translocon-associated protein subunit alpha OS=Ara... [more]
SSRA_DICDI7.690e-1733.33Translocon-associated protein subunit alpha OS=Dic... [more]
SSRA_RAT1.659e-1130.00Translocon-associated protein subunit alpha OS=Rat... [more]
SSRA_PONAB2.167e-1130.00Translocon-associated protein subunit alpha OS=Pon... [more]
SSRA_HUMAN2.167e-1130.00Translocon-associated protein subunit alpha OS=Hom... [more]
SSRA_CANFA3.697e-1130.00Translocon-associated protein subunit alpha OS=Can... [more]
SSRA_BOVIN3.697e-1129.44Translocon-associated protein subunit alpha OS=Bos... [more]
back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34108H04EF PostHarvP1 Citrus clementina cDNA clone C34108H04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930771 ID=FC930771|Name=FC930771|organism=Citrus clementina|type=EST|length=693bp
GGATCACCTTCATTCAATTCCAAAGCGGCGTCGTGTCAATTCAGACAACA
AACAAACAACCATGGAGATGAAGACGTTTAGGGTTTTCTTCTTCGCTCTC
CTCCTTCTAGCCTCTCCTCTTCTTCAAGTTGCTAGGTGTCAATCGGATTC
GGAAACGGGAGTTGCAGAGACCGAAGGGGGTGATCTTGGGATTGTTGGTG
AGGATGCTCAAGATTTTGGTGATGGGACTTTTAGCCCTGCTCCAGGAGTG
GATACTGTCTGTATCTTCCCTAAAAATAGCGCCCGAGTGGTGGCTGCTGG
AGAAGAAACTGAACTACTGGTTGGGATGAAAAATGATGGGGAGTCAAGCG
TGAATGTGATTGCAATTCAGGCCAGTGTTCATCTCCCTTTTGATCACAGT
CTTTTGGTTCAAAATCTCACTGGACAGGCCTTTAACAATGCAACTGTGCC
GGTATCAGCTCAGGCTACCTTTCCATACATTTTTGCTGTCAGCAAGTTCT
TGCAGCCTGGAACTTTTGATCTTGTGGGCTCCATTGTTTATGAGGTAGAC
CAGCATCCTTACCAAAGCACCTTCTACAATGGTACCATTGAAGTTGTTGA
ATCTGGTGGGTTCATCAGCATTGAGTCCGTTTTTCTTGTTACCCTTGGAA
TTGCGCTTCTCGTCCTTTTTGGGTTATGGATTCATGGTCAAGT
back to top