FC930780

Overview
NameFC930780
Unique NameFC930780
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length723
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9469 contig Ccv1_Contig9469:11..733. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS21C_PEA (Small heat shock protein, chloroplastic OS=Pisum sativum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.340e-26
Identity = 76/227 (33.48%), Postives = 119/227 (52.42%), Query Frame = 2
Query:   20 SKTIS*KMASHLGICTPCASEIITGFPSYRSPPLLRNRDFCGRIKAVADNRGSLDHLQRSSLN------QSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            S  +S K  S +    PC    +  FP  R  P L  R+   +     DN+ +   + R + +      + +P++ +  +S  G+ D +   R+++QM++TM+RI ED     +T P +      G    R PW I++ E++ ++R D+PG+S+ DVKV VE+ +LVIK++  + N           E+ W    Y  Y TR+ LPDN E EK  AE+KDGVLYITI
Sbjct:   12 SPILSQKPGSSVKSTPPC----MASFPLRRQLPRLGLRNVRAQAGGDGDNKDNSVEVHRVNKDDQGTAVERKPRRSSIDISPFGLLDPWSPMRSMRQMLDTMDRIFED----AITIPGRN----IGGGEIRVPWEIKDEEHEIRMRFDMPGVSKEDVKVSVEDDVLVIKSDHREENGG---------EDCWSRKSYSCYDTRLKLPDNCEKEKVKAELKDGVLYITI 217          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS25P_ARATH (25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.719e-26
Identity = 74/217 (34.10%), Postives = 114/217 (52.53%), Query Frame = 2
Query:   59 ICTPCASEIITGFPSYRSPPLLRNRDFCGRIKAVADNRGSLDHLQR--------SSLNQSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWP-SQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            +C+P A        S     +   R    RI+A      S+D +Q+        SS+ +   ++    VS  G+ D     RT++QM++TM+R+ ED      T P S + R  SG    R PW I+E E++ K+R D+PG+S+ DVK+ VE+++LVIK E+ +           + ++ W      SY TR+ LPDN E +K  AE+K+GVL+ITI
Sbjct:   12 LCSPLAPSPSVSSKSATPFSVSFPRKIPSRIRAQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFED------TMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKE----------DSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITI 212          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS21C_SOLLC (Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.658e-25
Identity = 70/186 (37.63%), Postives = 104/186 (55.91%), Query Frame = 2
Query:  152 KAVADNRGSLDHLQRSSLN---------QSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            +A  DN+ +   +  SS           + +P + A  VS  G+ D     RT++QM++TM+R+ ED     +T+P +     SG    RTPW I + EN+ K+R D+PG+S+ DVKV VE  MLVIK E  +  +         ++  W  N Y SY TR++LPDNV  +K  AE+K+GVL+I+I
Sbjct:   49 RATGDNKDTSVDVHHSSAQGGNNQGTAVERRPTRMALDVSPFGVLDPMSPMRTMRQMIDTMDRLFEDT----MTFPGRNRA--SGTGEIRTPWDIHDDENEIKMRFDMPGLSKEDVKVSVENDMLVIKGEHKKEEDG-------RDKHSWGRN-YSSYDTRLSLPDNVVKDKIKAELKNGVLFISI 220          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS22C_PETHY (Small heat shock protein, chloroplastic OS=Petunia hybrida GN=HSP22 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.165e-25
Identity = 71/185 (38.38%), Postives = 110/185 (59.46%), Query Frame = 2
Query:  128 NRDFCGRIKAVADNRGSLDHLQRSSLNQSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            N+D    +    +N+G  +   + S  + +P++ A  VS  G+ D     RT++QMM+TM+R+ ED     +T+P  + R   G    R PW I++ EN+ K+R D+PG+S+ +VKV VE+ +LVIK E  ++ E+  D S       W  N Y SY TR++LPDNV+ +K  AE+K+GVL I+I
Sbjct:   61 NKDTSVDVHVSNNNQGGNN---QGSAVERRPRRMALDVSPFGLLDPMSPMRTMRQMMDTMDRLFEDT----MTFPGSRNR---GTGEIRAPWDIKDDENEIKMRFDMPGLSKEEVKVSVEDDVLVIKGEH-KKEESGKDDS-------WGRN-YSSYDTRLSLPDNVDKDKVKAELKNGVLLISI 226          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS22C_SOYBN (Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.824e-25
Identity = 65/176 (36.93%), Postives = 100/176 (56.82%), Query Frame = 2
Query:  164 DNRGSLDHLQRSSLN---QSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            DN   + H+ +       + +P++ A  +S  GI D +   R+++Q+++TM+R+ ED     +T+P +      G    R PW I++ E++ ++R D+PG+++ DVKV VE+ MLVIK       E   D S       W S  Y SY TR+ LPDN E +K  AE+K+GVLYITI
Sbjct:    6 DNSVEVQHVSKGDQGTAVEKKPRRTAMDISPFGILDPWSPMRSMRQILDTMDRVFEDT----MTFPGRN----IGGGEIRAPWDIKDEEHEIRMRFDMPGLAKEDVKVSVEDDMLVIKGGHKSEQEHGGDDS-------WSSRTYSSYDTRLKLPDNCEKDKVKAELKNGVLYITI 166          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS21C_WHEAT (Small heat shock protein, chloroplastic OS=Triticum aestivum GN=HSP21 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 4.672e-20
Identity = 59/175 (33.71%), Postives = 97/175 (55.43%), Query Frame = 2
Query:  161 ADNRGSLDHLQRSSLNQSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAE-KAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            A N G+    Q+ +  Q +P++    +S  G+ D     RT++QM++TM+R+ +D     V +P++  R  +   R R PW I E E + K+R D+PG+SR +V+V VE+  LVI+ E K +  E   +G     +  W      SY  R+ALPD  +  +  AE+K+GVL +++
Sbjct:   63 AQNAGN----QQGNAVQRRPRRAGFDISPFGLVDPMSPMRTMRQMLDTMDRLFDD----AVGFPTR--RSPAARARRRMPWDIMEDEKEVKMRFDMPGLSREEVRVMVEDDALVIRGEHKKEAGEGQGEGG----DGWWKERSVSSYDMRLALPDECDKSQVRAELKNGVLLVSV 223          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS26P_ORYSJ (26.7 kDa heat shock protein, chloroplastic OS=Oryza sativa subsp. japonica GN=HSP26.7 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.746e-19
Identity = 56/167 (33.53%), Postives = 94/167 (56.29%), Query Frame = 2
Query:  191 QRSSLNQSQPKKRAA--PVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQER-VRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            Q+ +  Q +P++ +A   +S  G+ D     RT++QM++TM+RI +D     + +P+   R + +G    R PW + E + + ++R D+PG+SR +VKV VE+  LVI+ E  +      +GS    +  W      SY  R+ALPD  +  K  AE+K+GVL +T+
Sbjct:   67 QQGNAVQRRPRRSSALDGISPFGLVDPMSPMRTMRQMLDTMDRIFDD---VALGFPATPRRSLATG--EVRMPWDVMEDDKEVRMRFDMPGLSREEVKVMVEDDALVIRGEHKKEEGEGAEGS---GDGWWKERSVSSYDMRLALPDECDKSKVRAELKNGVLLVTV 225          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS23C_CHERU (Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.246e-14
Identity = 53/164 (32.32%), Postives = 86/164 (52.44%), Query Frame = 2
Query:  221 KKRAAPVSSPG---------IWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNV-EFEKNSAEVKDGVLYITI 682
            +   AP+S  G         ++D F A R+V Q+M  M+++ME+PF             R   R  R  W +RE E   ++++D+PG+++ DVKV VE++ L+IK+E  +  E        EEE+         YS+RI L  N+ + +   AE+K+GVL +T+
Sbjct:   47 RSNRAPISRRGDFPASFFSDVFDPFRATRSVGQLMNLMDQLMENPF---------MAASRGSGRAMRRGWDVREDEEALELKVDMPGLAKEDVKVSVEDNTLIIKSEAEKETE--------EEEQR------RRYSSRIELTPNLYKIDGIKAEMKNGVLKVTV 187          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS23M_ARATH (23.6 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.6 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.534e-14
Identity = 51/159 (32.08%), Postives = 87/159 (54.72%), Query Frame = 2
Query:  209 QSQPKKRAAPVSSPGIWDSFPAARTVQQMMETMERIMEDPFAYGVTWPSQQERVRSGYRRGRTPWAIRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNV-EFEKNSAEVKDGVLYITI 682
            +S P++R    S   ++D F   R+V Q++  M++ ME+P        + +    SG RRG   W I+E ++   +R+D+PG+SR DVK+ +E+  LVI+ E          G   E+  E   +G   +++RI LPD + + ++  AE+K+GVL + I
Sbjct:   55 RSVPRRRGDFFSD--VFDPFSPTRSVSQVLNLMDQFMENPLL-----SATRGMGASGARRG---WDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGE----------GKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVI 193          
BLAST of FC930780 vs. ExPASy Swiss-Prot
Match: HS26M_ARATH (26.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP26.5 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.456e-13
Identity = 35/92 (38.04%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  407 IRETENDYKIRLDVPGMSRNDVKVRVEESMLVIKAEKAQRNEANTDGSTVEEEEEWPSNGYGSYSTRIALPDNVEFEKNSAEVKDGVLYITI 682
            ++E ++ YK+R +VPG+++ DVK+ V + +L IK +    ++A  +  + EE+E W S  YG Y+T ++LPD+ + E   AE+K+GVL + I
Sbjct:  129 VKEQDDCYKLRYEVPGLTKEDVKITVNDGILTIKGD----HKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDAKVEDIKAELKNGVLNLVI 216          
The following BLAST results are available for this feature:
BLAST of FC930780 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
HS21C_PEA3.340e-2633.48Small heat shock protein, chloroplastic OS=Pisum s... [more]
HS25P_ARATH9.719e-2634.1025.3 kDa heat shock protein, chloroplastic OS=Arab... [more]
HS21C_SOLLC1.658e-2537.63Small heat shock protein, chloroplastic OS=Solanum... [more]
HS22C_PETHY2.165e-2538.38Small heat shock protein, chloroplastic OS=Petunia... [more]
HS22C_SOYBN4.824e-2536.93Small heat shock protein, chloroplastic (Fragment)... [more]
HS21C_WHEAT4.672e-2033.71Small heat shock protein, chloroplastic OS=Triticu... [more]
HS26P_ORYSJ6.746e-1933.5326.7 kDa heat shock protein, chloroplastic OS=Oryz... [more]
HS23C_CHERU2.246e-1432.32Small heat shock protein, chloroplastic OS=Chenopo... [more]
HS23M_ARATH8.534e-1432.0823.6 kDa heat shock protein, mitochondrial OS=Arab... [more]
HS26M_ARATH1.456e-1338.0426.5 kDa heat shock protein, mitochondrial OS=Arab... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34109A01EF PostHarvP1 Citrus clementina cDNA clone C34109A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930780 ID=FC930780|Name=FC930780|organism=Citrus clementina|type=EST|length=723bp
GATTGGTGACATCTCTCAATCAAAAACTATATCTTAGAAAATGGCATCTC
ATCTTGGTATCTGTACTCCCTGTGCGTCCGAAATAATCACCGGTTTTCCC
AGCTACAGGTCTCCACCTTTGTTGAGAAATAGAGACTTTTGTGGCAGGAT
AAAGGCCGTGGCAGATAACAGAGGCAGCCTTGATCACTTGCAAAGATCGT
CGCTGAATCAATCCCAGCCAAAAAAGAGAGCGGCCCCAGTTTCATCTCCA
GGGATATGGGATAGTTTTCCTGCTGCGAGGACGGTGCAACAGATGATGGA
AACCATGGAAAGAATAATGGAGGATCCTTTTGCTTACGGAGTCACTTGGC
CTTCACAACAAGAAAGGGTGAGAAGTGGATACAGACGGGGAAGAACGCCT
TGGGCCATCAGGGAAACGGAAAACGACTACAAGATTAGGTTAGACGTGCC
TGGCATGAGCAGGAATGATGTTAAGGTACGGGTTGAAGAGAGCATGCTCG
TAATCAAGGCAGAAAAGGCTCAAAGGAACGAAGCAAACACTGATGGAAGT
ACAGTTGAGGAAGAAGAAGAGTGGCCAAGCAATGGTTACGGAAGCTACAG
CACTAGAATTGCATTGCCTGACAACGTAGAGTTTGAGAAGAATTCAGCAG
AGGTGAAAGATGGCGTACTGTATATAACCATTCCAAGGCCAGCTCCACGC
CNAAATCGTCGACATTAATGTCC
back to top