FC930781

Overview
NameFC930781
Unique NameFC930781
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PPR87_ARATH (Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 3.196e-74
Identity = 81/133 (60.90%), Postives = 100/133 (75.19%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLS 400
            + NALL A  +AKDYKE KRV+IE PK YGI+PDL+TYNR+IK FCE         I+AEM+RK IKPN+SSFG +++GFY E+K ++V KVL MM+  G+  GVS YN+RI SLCK +K  EAKALLD MLS
Sbjct:  153 SLNALLFACLVAKDYKEAKRVYIEMPKMYGIEPDLETYNRMIKVFCESGSASSSYSIVAEMERKGIKPNSSSFGLMISGFYAEDKSDEVGKVLAMMKDRGVNIGVSTYNIRIQSLCKRKKSKEAKALLDGMLS 285          

HSP 2 Score: 133.65 bits (335), Expect = 3.196e-74
Identity = 58/91 (63.74%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            GMKPN+VTYSH I+GFC + +FEEAKK ++IM N G  P+S  YFT++Y++CKGGD+ETAL  CKES+ K WVP+F+ MKSLV GLA  SK
Sbjct:  287 GMKPNTVTYSHLIHGFCNEDDFEEAKKLFKIMVNRGCKPDSECYFTLIYYLCKGGDFETALSLCKESMEKNWVPSFSIMKSLVNGLAKDSK 377          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PPR33_ARATH (Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 7.623e-64
Identity = 72/133 (54.14%), Postives = 99/133 (74.44%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLS 400
            + NALL A  +AKDYKE  RV++E PK YGI+PDL+TYNR+I+  CE         I+AEM+RK IKP A+SFG ++ GFYKEEK+++V KV++MM+ +G+  GV+ YN+ I  LCK +K AEAKAL+D ++S
Sbjct:  148 SLNALLFACLMAKDYKEANRVYLEMPKMYGIEPDLETYNRMIRVLCESGSTSSSYSIVAEMERKWIKPTAASFGLMIDGFYKEEKFDEVRKVMRMMDEFGVHVGVATYNIMIQCLCKRKKSAEAKALIDGVMS 280          

HSP 2 Score: 108.997 bits (271), Expect = 7.623e-64
Identity = 48/90 (53.33%), Postives = 65/90 (72.22%), Query Frame = 1
Query:  406 MKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            M+PNSVTYS  I+GFC + N +EA   + +M  +G  P+S  YFT+++ +CKGGD+ETAL  C+ES+ K WVP+F+ MK LV GLA  SK
Sbjct:  283 MRPNSVTYSLLIHGFCSEENLDEAMNLFEVMVCNGYKPDSECYFTLIHCLCKGGDFETALILCRESMEKNWVPSFSVMKWLVNGLASRSK 372          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP134_ARATH (Pentatricopeptide repeat-containing protein At1g80150, mitochondrial OS=Arabidopsis thaliana GN=At1g80150 PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.468e-25
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  406 MKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            ++P+S+TY+  I GF      + A++ Y  M   G  PN  +Y TM++++CK G+++ A   CK+ + K W PN  T++ L+ GL
Sbjct:  278 VEPDSITYNMVIKGFFLARFPDMAERVYTAMHGKGYKPNLKIYQTMIHYLCKAGNFDLAYTMCKDCMRKKWYPNLDTVEMLLKGL 362          

HSP 2 Score: 65.855 bits (159), Expect = 2.468e-25
Identity = 37/128 (28.91%), Postives = 61/128 (47.66%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALL 385
            +FNA L  L+   D   +     + P  YGI  D  ++N  IK+FCE          + EM++  + P+  ++  L++  YK E+    N +  +M   G K  ++ +NVRI  L   R+  +A  LL
Sbjct:  143 SFNAALQVLSFNPDLHTIWEFLHDAPSKYGIDIDAVSFNIAIKSFCELGILDGAYMAMREMEKSGLTPDVVTYTTLISALYKHERCVIGNGLWNLMVLKGCKPNLTTFNVRIQFLVNRRRAWDANDLL 270          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP225_ARATH (Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.194e-25
Identity = 42/131 (32.06%), Postives = 68/131 (51.91%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEM 394
            +FNALL A   +K   E  + F E P+  GI PDL TYN +IKA C          I  E+++   +P+  SF  L+  FY+ E + + +++  +M+   +   +  YN R+  L + +K  +A  L+D M
Sbjct:  159 SFNALLSAYVNSKKLDEAMKTFKELPEKLGITPDLVTYNTMIKALCRKGSMDDILSIFEELEKNGFEPDLISFNTLLEEFYRRELFVEGDRIWDLMKSKNLSPNIRSYNSRVRGLTRNKKFTDALNLIDVM 289          

HSP 2 Score: 52.373 bits (124), Expect = 3.194e-25
Identity = 28/91 (30.77%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            G+ P+  TY+  I  +  D N EE  K Y  M   GL+P++  Y  ++  +CK GD + A+   +E+I    +      K +V  L G  K
Sbjct:  293 GISPDVHTYNALITAYRVDNNLEEVMKCYNEMKEKGLTPDTVTYCMLIPLLCKKGDLDRAVEVSEEAIKHKLLSRPNMYKPVVERLMGAGK 383          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PPR82_ARATH (Pentatricopeptide repeat-containing protein At1g55890, mitochondrial OS=Arabidopsis thaliana GN=At1g55890 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.824e-24
Identity = 40/131 (30.53%), Postives = 65/131 (49.62%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEM 394
            +FNALL A  ++K +  V+ +F E P    IKPD+ +YN +IKA CE         +L E++ K +KP+  +F  L+   Y + ++E   ++   M    +   +  YN R+  L    K  E   L  E+
Sbjct:  146 SFNALLSAYRLSKKFDVVEELFNELPGKLSIKPDIVSYNTLIKALCEKDSLPEAVALLDEIENKGLKPDIVTFNTLLLSSYLKGQFELGEEIWAKMVEKNVAIDIRTYNARLLGLANEAKSKELVNLFGEL 276          

HSP 2 Score: 59.3066 bits (142), Expect = 5.824e-24
Identity = 28/91 (30.77%), Postives = 53/91 (58.24%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            G+KP+  +++  I G   +G  +EA+ +Y+ +   G  P+ + +  ++  MCK GD+E+A+   KE+ +K ++   TT++ LV  L   SK
Sbjct:  280 GLKPDVFSFNAMIRGSINEGKMDEAEAWYKEIVKHGYRPDKATFALLLPAMCKAGDFESAIELFKETFSKRYLVGQTTLQQLVDELVKGSK 370          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP352_ARATH (Pentatricopeptide repeat-containing protein At4g36680, mitochondrial OS=Arabidopsis thaliana GN=At4g36680 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.283e-23
Identity = 27/86 (31.40%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            G+KP++++Y++ +  +C+ G  +EAKK Y  +  +  +PN++ + T+++ +C    YE      K+S+    +P+F T+K LV GL
Sbjct:  273 GLKPDTISYNYLMTAYCERGMLDEAKKVYEGLEGNNCAPNAATFRTLIFHLCYSRLYEQGYAIFKKSVYMHKIPDFNTLKHLVVGL 358          

HSP 2 Score: 62.003 bits (149), Expect = 1.283e-23
Identity = 40/134 (29.85%), Postives = 70/134 (52.24%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYG-IKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLS 400
            +FNALL A   +K++ +V ++F E P+ Y  I PD  +Y  +IK++C+         I+ +M  K ++    +F  +++  YK+ + E  + +   M + G +   + YNVRI S  K       K L++EM S
Sbjct:  139 SFNALLNACLHSKNFDKVPQLFDEIPQRYNKIIPDKISYGILIKSYCDSGTPEKAIEIMRQMQGKGMEVTTIAFTTILSSLYKKGELEVADNLWNEMVKKGCELDNAAYNVRIMSAQK-ESPERVKELIEEMSS 271          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP226_ARATH (Pentatricopeptide repeat-containing protein At3g13160, mitochondrial OS=Arabidopsis thaliana GN=At3g13160 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.055e-22
Identity = 39/135 (28.89%), Postives = 67/135 (49.63%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSKE 406
            +FNALL A   +K +  V+ +F E P    I+PD+ +YN +IK  C          ++ E++ K +KP+  +F  L+   Y + K+E+  ++   M    +K  +  YN R+  L    K  E  +L D++   E
Sbjct:  143 SFNALLNACVNSKKFDLVEGIFKELPGKLSIEPDVASYNTLIKGLCGKGSFTEAVALIDEIENKGLKPDHITFNILLHESYTKGKFEEGEQIWARMVEKNVKRDIRSYNARLLGLAMENKSEEMVSLFDKLKGNE 277          

HSP 2 Score: 55.4546 bits (132), Expect = 1.055e-22
Identity = 28/90 (31.11%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  406 MKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            +KP+  T++  I GF  +G  +EA  +Y+ +  +G  P   V+ +++  +CK GD E+A   CKE  AK  + +   ++ +V  L   SK
Sbjct:  278 LKPDVFTFTAMIKGFVSEGKLDEAITWYKEIEKNGCRPLKFVFNSLLPAICKAGDLESAYELCKEIFAKRLLVDEAVLQEVVDALVKGSK 367          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP120_ARATH (Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 5.054e-22
Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            G KP+ +TY++ IYG CK+  F+EA+ +   M N GL P+S  Y T++   CKGG  + A     +++  G+VP+  T +SL+ GL
Sbjct:  281 GPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNEGLEPDSYTYNTLIAGYCKGGMVQLAERIVGDAVFNGFVPDQFTYRSLIDGL 366          

HSP 2 Score: 51.9878 bits (123), Expect = 5.054e-22
Identity = 30/134 (22.39%), Postives = 66/134 (49.25%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            ++NA++  L  +  + +  +V++   +  GI PD+ ++   +K+FC+         +L  M  +  + N  ++  +V GFY+E    +  ++   M   G+   +S +N  +  LCK     E + LLD+++ +
Sbjct:  113 SYNAIMSVLVDSGYFDQAHKVYMRM-RDRGITPDVYSFTIRMKSFCKTSRPHAALRLLNNMSSQGCEMNVVAYCTVVGGFYEENFKAEGYELFGKMLASGVSLCLSTFNKLLRVLCKKGDVKECEKLLDKVIKR 245          

HSP 3 Score: 53.5286 bits (127), Expect = 5.920e-15
Identity = 26/87 (29.89%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLA 663
            G++P+S TY+  I G+CK G  + A++       +G  P+   Y +++  +C  G+   AL    E++ KG  PN     +L+ GL+
Sbjct:  316 GLEPDSYTYNTLIAGYCKGGMVQLAERIVGDAVFNGFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLS 402          

HSP 4 Score: 47.3654 bits (111), Expect = 5.920e-15
Identity = 23/105 (21.90%), Postives = 52/105 (49.52%), Query Frame = 2
Query:   89 GIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            G+   L T+N++++  C+         +L ++ ++ + PN  ++   + G  +  + +   +++  +   G K  V  YN  I+ LCK  K  EA+  L +M+++
Sbjct:  211 GVSLCLSTFNKLLRVLCKKGDVKECEKLLDKVIKRGVLPNLFTYNLFIQGLCQRGELDGAVRMVGCLIEQGPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNE 315          

HSP 5 Score: 50.0618 bits (118), Expect = 2.191e-14
Identity = 24/85 (28.24%), Postives = 42/85 (49.41%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTG 657
            G+ P+  TY+  + G CK   FE+  + Y+ M   G +PN   +  ++  +C+    + ALG  +E   K   P+  T  +L+ G
Sbjct:  491 GVDPDVYTYNSLLNGLCKTSKFEDVMETYKTMVEKGCAPNLFTFNILLESLCRYRKLDEALGLLEEMKNKSVNPDAVTFGTLIDG 575          

HSP 6 Score: 48.9062 bits (115), Expect = 2.191e-14
Identity = 27/105 (25.71%), Postives = 45/105 (42.86%), Query Frame = 2
Query:   89 GIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            G  PD  TY  +I   C          +  E   K IKPN   +  L+ G   +    +  ++   M   G+   V  +N+ ++ LCK+   ++A  L+  M+SK
Sbjct:  351 GFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGLIPEVQTFNILVNGLCKMGCVSDADGLVKVMISK 455          

HSP 7 Score: 49.6766 bits (117), Expect = 5.054e-13
Identity = 31/116 (26.72%), Postives = 52/116 (44.83%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCK 352
            FN LL  L    D KE +++  +  K  G+ P+L TYN  I+  C+         ++  +  +  KP+  ++  L+ G  K  K+++    L  M   G++     YN  I   CK
Sbjct:  219 FNKLLRVLCKKGDVKECEKLLDKVIKR-GVLPNLFTYNLFIQGLCQRGELDGAVRMVGCLIEQGPKPDVITYNNLIYGLCKNSKFQEAEVYLGKMVNEGLEPDSYTYNTLIAGYCK 333          

HSP 8 Score: 44.669 bits (104), Expect = 5.054e-13
Identity = 25/86 (29.07%), Postives = 34/86 (39.53%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            G  P+  TY   I G C +G    A   +      G+ PN  +Y T++  +   G    A     E   KG +P   T   LV GL
Sbjct:  351 GFVPDQFTYRSLIDGLCHEGETNRALALFNEALGKGIKPNVILYNTLIKGLSNQGMILEAAQLANEMSEKGLIPEVQTFNILVNGL 436          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PP407_ARATH (Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 8.557e-22
Identity = 33/98 (33.67%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSKSVKQRAY 696
            G   + VTY+  I G+CK+GNF +A   +  M   GL+P+   Y ++++ MCK G+   A+ F  +   +G  PN  T  +LV G +   K     AY
Sbjct:  305 GYSLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLIHSMCKAGNMNRAMEFLDQMRVRGLCPNERTYTTLVDGFS--QKGYMNEAY 400          

HSP 2 Score: 60.077 bits (144), Expect = 8.557e-22
Identity = 38/132 (28.79%), Postives = 68/132 (51.52%), Query Frame = 2
Query:    2 AFNALLLALTIAK-DYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEM 394
            ++NA+L A   +K +    + VF E  ++  + P++ TYN +I+ FC          +  +M+ K   PN  ++  L+ G+ K  K +D  K+L+ M   G++  +  YNV I+ LC+  +  E   +L EM
Sbjct:  171 SYNAVLDATIRSKRNISFAENVFKEMLESQ-VSPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTYNTLIDGYCKLRKIDDGFKLLRSMALKGLEPNLISYNVVINGLCREGRMKEVSFVLTEM 301          

HSP 3 Score: 65.0846 bits (157), Expect = 1.264e-19
Identity = 33/92 (35.87%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSKS 678
            G+KP+++TYS  I GFC+    +EA   Y  M   GL P+   Y  ++   C  GD E AL    E + KG +P+  T   L+ GL   S++
Sbjct:  480 GIKPDTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQLHNEMVEKGVLPDVVTYSVLINGLNKQSRT 571          

HSP 4 Score: 51.6026 bits (122), Expect = 1.264e-19
Identity = 29/106 (27.36%), Postives = 50/106 (47.17%), Query Frame = 2
Query:   86 YGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            +G+ P + TY  +I + C+          L +M  + + PN  ++  LV GF ++    +  +VL+ M   G    V  YN  I+  C   K  +A A+L++M  K
Sbjct:  339 HGLTPSVITYTSLIHSMCKAGNMNRAMEFLDQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALINGHCVTGKMEDAIAVLEDMKEK 444          

HSP 5 Score: 57.7658 bits (138), Expect = 1.747e-18
Identity = 30/102 (29.41%), Postives = 48/102 (47.06%), Query Frame = 2
Query:   89 GIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEM 394
            G++P+L +YN VI   C          +L EM+R+    +  ++  L+ G+ KE  +     +   M R+G+   V  Y   IHS+CK      A   LD+M
Sbjct:  270 GLEPNLISYNVVINGLCREGRMKEVSFVLTEMNRRGYSLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLIHSMCKAGNMNRAMEFLDQM 371          

HSP 6 Score: 55.0694 bits (131), Expect = 1.747e-18
Identity = 30/85 (35.29%), Postives = 42/85 (49.41%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTG 657
            G  P+ VTY+  I G C  G  E+A      M   GLSP+   Y T++   C+  D + AL   +E + KG  P+  T  SL+ G
Sbjct:  410 GFSPSVVTYNALINGHCVTGKMEDAIAVLEDMKEKGLSPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTITYSSLIQG 494          

HSP 7 Score: 54.6842 bits (130), Expect = 1.512e-16
Identity = 35/131 (26.72%), Postives = 59/131 (45.04%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEML 397
            +N L+     A +  +V     +  +T G  P++ TYN +I  +C+         +L  M  K ++PN  S+  ++ G  +E + ++V+ VL  M R G       YN  I   CK     +A  +  EML
Sbjct:  208 YNILIRGFCFAGNI-DVALTLFDKMETKGCLPNVVTYNTLIDGYCKLRKIDDGFKLLRSMALKGLEPNLISYNVVINGLCREGRMKEVSFVLTEMNRRGYSLDEVTYNTLIKGYCKEGNFHQALVMHAEML 337          

HSP 8 Score: 51.6026 bits (122), Expect = 1.512e-16
Identity = 27/85 (31.76%), Postives = 40/85 (47.06%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTG 657
            G+ P+ +TY+  I+  CK GN   A +F   M   GL PN   Y T+V    + G    A    +E    G+ P+  T  +L+ G
Sbjct:  340 GLTPSVITYTSLIHSMCKAGNMNRAMEFLDQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALING 424          

HSP 9 Score: 54.299 bits (129), Expect = 6.244e-14
Identity = 39/135 (28.89%), Postives = 64/135 (47.41%), Query Frame = 2
Query:    2 AFNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSKE 406
            +++ +L     + D  E  RV  E  +  GIKPD  TY+ +I+ FCE         +  EM R  + P+  ++ AL+  +  E   E   ++   M   G+   V  Y+V I+ L K  +  EAK LL ++  +E
Sbjct:  452 SYSTVLSGFCRSYDVDEALRVKREMVEK-GIKPDTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQLHNEMVEKGVLPDVVTYSVLINGLNKQSRTREAKRLLLKLFYEE 585          

HSP 10 Score: 43.1282 bits (100), Expect = 6.244e-14
Identity = 22/74 (29.73%), Postives = 35/74 (47.30%), Query Frame = 1
Query:  439 IYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            I GFC  G   EA + +  M      P+ + Y  M++  C+ GD   A    KE +  G++ +  T+ +LV  L
Sbjct:  612 IKGFCMKGMMTEADQVFESMLGKNHKPDGTAYNIMIHGHCRAGDIRKAYTLYKEMVKSGFLLHTVTVIALVKAL 685          

HSP 11 Score: 50.8322 bits (120), Expect = 6.567e-13
Identity = 25/83 (30.12%), Postives = 42/83 (50.60%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLV 651
            G++PN ++Y+  I G C++G  +E       M+  G S +   Y T++   CK G++  AL    E +  G  P+  T  SL+
Sbjct:  270 GLEPNLISYNVVINGLCREGRMKEVSFVLTEMNRRGYSLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLI 352          

HSP 12 Score: 43.1282 bits (100), Expect = 6.567e-13
Identity = 31/130 (23.85%), Postives = 48/130 (36.92%), Query Frame = 2
Query:   32 IAKDYKEVKRV-----FIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXX-ILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            + K Y  +  +      +   + +G  P + +YN V+ A             +  EM    + PN  ++  L+ GF      +    +   ME  G    V  YN  I   CKLRK  +   LL  M  K
Sbjct:  140 VVKSYSRLSLIDKALSIVHLAQAHGFMPGVLSYNAVLDATIRSKRNISFAENVFKEMLESQVSPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTYNTLIDGYCKLRKIDDGFKLLRSMALK 269          
BLAST of FC930781 vs. ExPASy Swiss-Prot
Match: PPR96_ARATH (Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2)

HSP 1 Score: 64.3142 bits (155), Expect = 3.197e-21
Identity = 36/134 (26.87%), Postives = 65/134 (48.51%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSKE 406
            +  ++ AL   K+  +   +F E     GI+P++ TYN +I+  C          +L++M  + I PN  +F AL+  F KE K  +  K+   M +  +   +  Y+  I+  C   +  EAK + + M+SK+
Sbjct:  258 YTTIIDALCNYKNVNDALNLFTEMDNK-GIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKD 390          

HSP 2 Score: 57.7658 bits (138), Expect = 3.197e-21
Identity = 32/91 (35.16%), Postives = 46/91 (50.55%), Query Frame = 1
Query:  412 PNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSKSVK 684
            PN VTY+  I GFCK    EE  + +R MS  GL  N+  Y T++  + + GD + A    K+ ++ G  P+  T   L+ GL    K  K
Sbjct:  393 PNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEK 483          

HSP 3 Score: 56.6102 bits (135), Expect = 3.331e-16
Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            G+KPN + Y+  I GFC+ G  EEA   +R M   G  PNS  Y T++    + GD   +    KE  + G+V + +T+  ++  L
Sbjct:  530 GVKPNVIIYTTMISGFCRKGLKEEADALFREMKEDGTLPNSGTYNTLIRARLRDGDKAASAELIKEMRSCGFVGDASTISMVINML 615          

HSP 4 Score: 48.521 bits (114), Expect = 3.331e-16
Identity = 22/97 (22.68%), Postives = 46/97 (47.42%), Query Frame = 2
Query:   98 PDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLD 388
            P++ TYN +IK FC+         +  EM ++ +  N  ++  L+ G ++    +   K+ + M   G+   +  Y++ +  LCK  K  +A  + +
Sbjct:  393 PNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGLFQAGDCDMAQKIFKKMVSDGVPPDIITYSILLDGLCKYGKLEKALVVFE 489          

HSP 5 Score: 52.7582 bits (125), Expect = 9.503e-16
Identity = 27/83 (32.53%), Postives = 39/83 (46.99%), Query Frame = 1
Query:  412 PNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGL 660
            P+  TYS  I GFC     +EAK  + +M +    PN   Y T++   CK    E  +   +E   +G V N  T  +L+ GL
Sbjct:  358 PDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREMSQRGLVGNTVTYNTLIQGL 440          

HSP 6 Score: 50.8322 bits (120), Expect = 9.503e-16
Identity = 27/104 (25.96%), Postives = 48/104 (46.15%), Query Frame = 2
Query:   92 IKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            I+ D+  Y  +I A C          +  EMD K I+PN  ++ +L+       ++ D +++L  M    +   V  ++  I +  K  K  EA+ L DEM+ +
Sbjct:  251 IEADVVIYTTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKR 354          

HSP 7 Score: 51.2174 bits (121), Expect = 1.304e-14
Identity = 31/98 (31.63%), Postives = 48/98 (48.98%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALG-FCKESIAKGWVPNFTTMKSLVTGLAGVSKSVKQRA 693
            G+ P+ +TYS  + G CK G  E+A   +  +  S + P+   Y  M+  MCK G  E     FC  S+ KG  PN     ++++G     K +K+ A
Sbjct:  460 GVPPDIITYSILLDGLCKYGKLEKALVVFEYLQKSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSL-KGVKPNVIIYTTMISGFC--RKGLKEEA 554          

HSP 8 Score: 48.521 bits (114), Expect = 1.304e-14
Identity = 29/130 (22.31%), Postives = 60/130 (46.15%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEM 394
            +N+L+  L     + +  R+  +  +   I P++ T++ +I AF +         +  EM ++SI P+  ++ +L+ GF   ++ ++   + ++M        V  YN  I   CK ++  E   L  EM
Sbjct:  293 YNSLIRCLCNYGRWSDASRLLSDMIERK-INPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVEEGMELFREM 421          

HSP 9 Score: 50.0618 bits (118), Expect = 1.785e-13
Identity = 30/134 (22.39%), Postives = 58/134 (43.28%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSKE 406
            FN L+  L +     E   + I+     G +PDL TY  V+   C+         +L +M++  I+ +   +  ++      +   D   +   M+  G++  V  YN  I  LC   + ++A  LL +M+ ++
Sbjct:  188 FNTLIHGLFLHNKASEAVAL-IDRMVARGCQPDLFTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYTTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERK 320          

HSP 10 Score: 45.8246 bits (107), Expect = 1.785e-13
Identity = 25/84 (29.76%), Postives = 39/84 (46.43%), Query Frame = 1
Query:  406 MKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTG 657
            + PN VT+S  I  F K+G   EA+K Y  M    + P+   Y +++   C     + A    +  I+K   PN  T  +L+ G
Sbjct:  321 INPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKG 404          

HSP 11 Score: 44.2838 bits (103), Expect = 5.578e-11
Identity = 32/133 (24.06%), Postives = 59/133 (44.36%), Query Frame = 2
Query:    5 FNALLLALTIAKDYKEVKRVFIEFPKTYGIKPDLDTYNRVIKAFCEXXXXXXXXXILAEMDRKSIKPNASSFGALVAGFYKEEKYEDVNKVLQMMERYGMKSGVSMYNVRIHSLCKLRKCAEAKALLDEMLSK 403
            FN LL A+     +  V  +  E  +   I  DL +YN +I  FC          +L +M +   +P+  +  +L+ G+   ++  +   ++  M     +     +N  IH L    K +EA AL+D M+++
Sbjct:   83 FNKLLSAIAKMNKFDLVISLG-ERMQNLRISYDLYSYNILINCFCRRSQLPLALAVLGKMMKLGYEPDIVTLSSLLNGYCHGKRISEAVALVDQMFVMEYQPNTVTFNTLIHGLFLHNKASEAVALIDRMVAR 214          

HSP 12 Score: 43.1282 bits (100), Expect = 5.578e-11
Identity = 24/91 (26.37%), Postives = 39/91 (42.86%), Query Frame = 1
Query:  403 GMKPNSVTYSHFIYGFCKDGNFEEAKKFYRIMSNSGLSPNSSVYFTMVYFMCKGGDYETALGFCKESIAKGWVPNFTTMKSLVTGLAGVSK 675
            G +P+  TY   + G CK G+ + A    + M    +  +  +Y T++  +C   +   AL    E   KG  PN  T  SL+  L    +
Sbjct:  215 GCQPDLFTYGTVVNGLCKRGDIDLALSLLKKMEKGKIEADVVIYTTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGR 305          
The following BLAST results are available for this feature:
BLAST of FC930781 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 113
Match NameE-valueIdentityDescription
PPR87_ARATH3.196e-7460.90Pentatricopeptide repeat-containing protein At1g61... [more]
PPR33_ARATH7.623e-6454.14Pentatricopeptide repeat-containing protein At1g11... [more]
PP134_ARATH2.468e-2535.29Pentatricopeptide repeat-containing protein At1g80... [more]
PP225_ARATH3.194e-2532.06Pentatricopeptide repeat-containing protein At3g13... [more]
PPR82_ARATH5.824e-2430.53Pentatricopeptide repeat-containing protein At1g55... [more]
PP352_ARATH1.283e-2331.40Pentatricopeptide repeat-containing protein At4g36... [more]
PP226_ARATH1.055e-2228.89Pentatricopeptide repeat-containing protein At3g13... [more]
PP120_ARATH5.054e-2239.53Putative pentatricopeptide repeat-containing prote... [more]
PP407_ARATH8.557e-2233.67Pentatricopeptide repeat-containing protein At5g39... [more]
PPR96_ARATH3.197e-2126.87Pentatricopeptide repeat-containing protein At1g62... [more]

Pages

back to top
Libraries
Library NameType
PostHarvP1cdna_library
Properties
Property NameValue
Genbank descriptionC34109A02EF PostHarvP1 Citrus clementina cDNA clone C34109A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930781 ID=FC930781|Name=FC930781|organism=Citrus clementina|type=EST|length=701bp
GGCTTTCAACGCTTTGTTGTTGGCTCTCACGATAGCCAAAGACTACAAAG
AAGTTAAACGGGTATTTATCGAATTTCCCAAGACTTACGGAATCAAGCCG
GATTTGGATACCTACAACAGGGTAATTAAGGCGTTTTGTGAGTCCAGTGA
TTCAAGTTCTGCAGACTCGATTTTGGCTGAAATGGATAGGAAGTCGATTA
AACCAAACGCCTCGAGTTTTGGAGCTTTGGTGGCTGGGTTTTATAAGGAG
GAGAAGTATGAAGATGTGAATAAAGTCTTGCAAATGATGGAAAGATATGG
GATGAAGTCTGGGGTTAGTATGTATAATGTGAGGATTCATAGCCTTTGTA
AGTTAAGAAAGTGTGCAGAAGCTAAGGCATTGCTTGATGAGATGTTGTCT
AAGGAATGAAGCCGAATTCAGTCACTTATAGCCATTTCATTTATGGGTTC
TGCAAAGATGGGAATTTTGAAGAAGCTAAGAAGTTTTATAGGATTATGAG
TAACAGTGGGTTGTCGCCAAATAGCTCTGTATATTTTACTATGGTGTATT
TCATGTGTAAAGGTGGGGATTATGAGACAGCACTGGGCTTCTGCAAGGAG
AGTATAGCGAAGGGTTGGGTGCCTAATTTCACGACTATGAAATCATTGGT
GACTGGGCTGGCTGGTGTTTCAAAGTCAGTGAAGCAAAGAGCTTATTGGC
C
back to top