FC930808

Overview
NameFC930808
Unique NameFC930808
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length436
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11496 contig Ccv1_Contig11496:1..422. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930808 vs. ExPASy Swiss-Prot
Match: GSR2_ARATH (Uncharacterized protein At2g40430 OS=Arabidopsis thaliana GN=At2g40430 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 2.310e-29
Identity = 61/85 (71.76%), Postives = 74/85 (87.06%), Query Frame = 3
Query:   84 MGKIAKGSRKGKKAWGANISTEDIEDFFEQSNKDALSGGSLSQLPNDSLFYVDNSKDLSVKRKIEKHREKVLRCDSVLQKNPFVR 338
            MGK +K SRKGKKAW ANIS+EDIEDFFE++ +DALSGG+LS  P++ LF+VD S DL VKRKIEKHRE+VLR DS+L+KNPFV+
Sbjct:    1 MGKRSKTSRKGKKAWRANISSEDIEDFFEKTTRDALSGGNLSAAPSEDLFHVDKSHDLPVKRKIEKHRERVLRVDSILKKNPFVQ 85          
The following BLAST results are available for this feature:
BLAST of FC930808 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GSR2_ARATH2.310e-2971.76Uncharacterized protein At2g40430 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionC34109C05EF PostHarvP1 Citrus clementina cDNA clone C34109C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930808 ID=FC930808|Name=FC930808|organism=Citrus clementina|type=EST|length=436bp
GCTTTTTGCTTCGGCATTCGCAACAGCGGCAGCGGCAGCGGCAGCGGAGG
CGCAGACACCACAAACAGAGAAGCAAAGAAGAGATGGGGAAGATAGCAAA
AGGGTCGAGGAAGGGAAAGAAAGCGTGGGGAGCTAACATAAGCACAGAAG
ATATAGAAGATTTCTTTGAGCAATCAAATAAAGACGCTCTCTCCGGTGGC
TCTCTTTCTCAGCTTCCGAACGACTCCCTTTTCTACGTCGACAACTCCAA
AGATCTTTCGGTGAAGCGGAAGATTGAGAAACATAGGGAAAAGGTACTCC
GCTGTGACAGTGTGCTGCAGAAGAATCCTTTTGTTCGGGCATTGCCATCG
TCAAAGCCGAAGCAGAAGAAGAAATCCAAGAAAGAGAATAAGGATGTTGT
GAAAGAAAAGGATGAAACTCGGGATGGTCAGAAGAG
back to top