FC930811

Overview
NameFC930811
Unique NameFC930811
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length744
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15504 contig Ccv1_Contig15504:32..775. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 8.863e-70
Identity = 130/232 (56.03%), Postives = 166/232 (71.55%), Query Frame = 3
Query:   36 EQKMAQIGSSLLVPCVQELVKNPALV-VPDRYIRPDQDSPLISDDTLIS-QIPVIDMQXXXXXXXXXXXXAKLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMREFFEKWSA--AMRMNYYPPCPQPEKXMGLSPH 719
            E K A   SS+LVP VQE+VK   +  VP RY+R DQD   + DD  +  +IP+IDM+             KLDF CKEWGFFQLVNHG+ ++FL+K+K E++ FFNL MEEKKK+WQ P ++EGFGQAFVVSE+QKLDWADLF     PV LRKPHLFPKLP   R+TLE+YS E++S+A+ LI+ M   L IK EE+ + F+   +  +MRMNYYPPCPQP++ +GL+PH
Sbjct:    2 EAKGAAQWSSILVPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKRLCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPH 233          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: NCS1_COPJA (S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.993e-37
Identity = 91/233 (39.06%), Postives = 126/233 (54.08%), Query Frame = 3
Query:   39 QKMAQIGSSLLVPCVQELVKNPALVVPDRYIRPD--QDSPLISDDTLISQIPVIDMQXXXXXXXXXXXXAKLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDE----EMREFFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            + +  +G SL V  VQ L       +P+RY+RP+   D  +  D++L  +IPVID+             AK    C +WGFFQL+NHG+    +EK+K + E FF L  +EK  Y Q P  MEG+GQAFV SEEQKLDWAD+  ++T PV  R    +P  P S RET+E YSMEL+ +A  L   M + L ++ E     +R  F +    +     P      + +GLSPH
Sbjct:    3 KNLTGVGGSLPVENVQVLAGKELKNLPNRYVRPELEHDDVVPIDNSL--EIPVIDLSRLLDQQYACDELAKFHSACLDWGFFQLINHGVREEVIEKMKVDTEDFFRLPFKEKNAYRQLPNGMEGYGQAFVTSEEQKLDWADMHFLITKPVQERNMRFWPTSPTSFRETMEKYSMELQKVAMCLTGMMAKNLGLESEILTKPLRTVFNREDELL-----PSMSSCGEGLGLSPH 228          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: LDOX_ARATH (Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.481e-24
Identity = 68/226 (30.09%), Postives = 110/226 (48.67%), Query Frame = 3
Query:   81 VQELVKNPALVVPDRYIRPDQDSPLISDDTLIS------QIPVIDMQXXXXXXXXXXXXA--KLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMRE---FFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            V+ L K+  + +P  YIRP ++   I+D  L        Q+P ID++               +L     +WG   L+NHG+    +E++KK  E FF+LS+EEK+KY   Q  G ++G+G     +   +L+W D F  L  P   R   ++PK P    E    Y+  L+ LA  +   +   L ++ + + +     E+    M++NYYP CPQPE  +G+  H
Sbjct:    7 VESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAH 232          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: LDOX_VITVI (Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.811e-22
Identity = 69/234 (29.49%), Postives = 108/234 (46.15%), Query Frame = 3
Query:   69 LVPCVQELVKNPALVVPDRYIRPDQDSPLISD------DTLISQIPVIDMQXXXXXXXXXXXXAK------LDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMRE---FFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            + P V+ L  +    +P  YIRP ++   I +           Q+P ID++             +      L     EWG   LVNHG+S   + ++K   E FFNL MEEK+KY   Q  G + G+G     +   +L+W D F  L  P   R   ++PK P         YS++L+SLA  ++S +   L +++  + +     E+     ++NYYP CPQPE  +G+  H
Sbjct:    5 VAPRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESEDEVVRREIRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASGKIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLATKILSVLSLGLGLEEGRLEKEVGGMEELLLQKKINYYPKCPQPELALGVEAH 238          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: FNSI_PETCR (Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.269e-22
Identity = 52/200 (26.00%), Postives = 99/200 (49.50%), Query Frame = 3
Query:  126 YIRPDQDSPLISDDTLISQIPVIDMQXXXXXXXXXXXXA--KLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMREFFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            ++R + + P ++ +   ++IP+I +                K+   C++WG FQ+V+HG+ +  + ++ +    FF L  EEK +Y    G   GF  + V+  +  +DW +  +  + P++ R    +PK P   R T EVYS +L  L   L+  + E + ++  ++ +        + +NYYP CPQP+  +G+  H
Sbjct:   19 FVRDEDERPKVAYNQFSNEIPIISLAGLDDDSDGRRPEICRKIVKACEDWGIFQVVDHGIDSGLISEMTRLSREFFALPAEEKLEYDTTGGKRGGFTISTVLQGDDAMDWREFVTYFSYPINARDYSRWPKKPEGWRSTTEVYSEKLMVLGAKLLEVLSEAMGLEKGDLTKACVDMEQKVLINYYPTCPQPDLTLGVRRH 218          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.174e-21
Identity = 63/226 (27.88%), Postives = 106/226 (46.90%), Query Frame = 3
Query:   81 VQELVKNPALVVPDRYIRPDQDSPLISD------DTLISQIPVIDMQXXXXXXXXXXXXA--KLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMRE---FFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            V+ L  +    +P  YIRP  +   I D      +    Q+P ID++               KL     +WG   LVNHG+S   ++K++K  + FF+L +E+K+KY   Q  G ++G+G     +   +L+W D F     P   R   ++P+ P    E    Y+ +L+ LA  ++  +   L + +  + +     E+    M++NYYP CPQPE  +G+  H
Sbjct:   11 VETLAGSGISTIPKEYIRPKDELVNIGDIFEQEKNNEGPQVPTIDLKEIESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPADYIEATAEYAKQLRELATKVLKVLSLGLGLDEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAH 236          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.415e-21
Identity = 60/229 (26.20%), Postives = 107/229 (46.72%), Query Frame = 3
Query:   75 PCVQELVKNPALVVPDRYIRPDQDSPLISDDTLIS-------QIPVIDMQXXXXXXXXXXXXA--KLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMREFF---EKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            P V+EL ++    +P  Y+RP+++   I  + L         Q+P ID++               +L     +WG   L+NHG+    ++++K   + FF L +EEK+ Y   Q  G+++G+G     +   +L+W D F     P H     ++P  PP        Y+ +L++LA  ++S +   L ++   + +     E     M++N+YP CPQPE  +G   H
Sbjct:   10 PRVEELARSGLDTIPKDYVRPEEELKSIIGNILAEEKSSEGPQLPTIDLEEMDSRDEEGRKKCHEELKKAATDWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAYANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVYPEHKTDLSIWPTKPPDYIPATSEYAKQLRALATKILSVLSIGLGLEKGRLEKEVGGAEDLIVQMKINFYPKCPQPELALGWEAH 238          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: GAOX1_ARATH (Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana GN=20ox1 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 5.826e-21
Identity = 61/223 (27.35%), Postives = 108/223 (48.43%), Query Frame = 3
Query:   90 LVKNPALV-----VPDRYIRPDQDSPLISDDTLISQIPVIDMQXXXXXXXXXXXXAKL-DFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYWQHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLR-------ETLEVYSMELKSLAENLISXMGEVLNIKDEEMREFFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            L+ NP+++     +P+++I PD + P I+   L   +P+ID+Q            ++L    CK+ GFF +VNHG+S   +    +    FF++ + EK++  +  G+  G+  +F      KL W +  S        R   +      +L        +  + Y   + SL+  ++  +G  L +K +  REFFE+  + MR+NYYPPC +P+  +G  PH
Sbjct:   27 LIFNPSMLNLQANIPNQFIWPDDEKPSIN--VLELDVPLIDLQNLLSDPSSTLDASRLISEACKKHGFFLVVNHGISEELISDAHEYTSRFFDMPLSEKQRVLRKSGESVGYASSFTGRFSTKLPWKETLSFRFCDDMSRSKSVQDYFCDALGHGFQPFGKVYQEYCEAMSSLSLKIMELLGLSLGVKRDYFREFFEENDSIMRLNYYPPCIKPDLTLGTGPH 247          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: LDOX_PETHY (Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.608e-21
Identity = 62/225 (27.56%), Postives = 106/225 (47.11%), Query Frame = 3
Query:   81 VQELVKNPALVVPDRYIRPDQDSPLISD------DTLISQIPVIDMQXXXXXXXXXXXXA-KLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMRE---FFEKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            V+ L K+    +P  Y+RP ++   I +           Q+P ID++              +L     EWG   LVNHG+S   + ++K   E FF+  +EEK+KY   Q  G+++G+G     S   +L+W D F     P   R   ++PK P         Y+ ++++LA  +++ +   L +++  + +     E     M++NYYP CPQPE  +G+  H
Sbjct:   12 VESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLKEIDSEDKEIREKCHQLKKAAMEWGVMHLVNHGISDELINRVKVAGETFFDQPVEEKEKYANDQANGNVQGYGSKLANSACGQLEWEDYFFHCAFPEDKRDLSIWPKNPTDYTPATSEYAKQIRALATKILTVLSIGLGLEEGRLEKEVGGMEDLLLQMKINYYPKCPQPELALGVEAH 236          
BLAST of FC930811 vs. ExPASy Swiss-Prot
Match: FLS1_ARATH (Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.937e-21
Identity = 64/220 (29.09%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   81 VQELVKNPALV--VPDRYIRPDQDSPLISDDT-LISQIPVIDMQXXXXXXXXXXXXAKLDFTCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEEKKKYW--QHPGDMEGFGQAFVVSEEQKLDWADLFSMLTLPVHLRKPHLFPKLPPSLRETLEVYSMELKSLAENLISXMGEVLNIKDEEMREFF--EKWSAAMRMNYYPPCPQPEKXMGLSPH 719
            VQ++  +  L   +P  +IR +++ P I+        IPV+D+                    +EWG FQ+VNHG+ T  + +L+     FF L   EK+     +   D+EG+G       E K  W D       P        +PK PP  RE  E Y++ +K L+E L+  + + L +K + ++E    E     M++NYYPPCP+P+  +G+  H
Sbjct:    6 VQDISSSSLLTEAIPLEFIRSEKEQPAITTFRGPTPAIPVVDLSDPDEESVRRAVVK----ASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEKESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPKNPPEYREVNEEYAVHVKKLSETLLGILSDGLGLKRDALKEGLGGEMAEYMMKINYYPPCPRPDLALGVPAH 221          
The following BLAST results are available for this feature:
BLAST of FC930811 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
SRG1_ARATH8.863e-7056.03Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
NCS1_COPJA1.993e-3739.06S-norcoclaurine synthase 1 OS=Coptis japonica GN=N... [more]
LDOX_ARATH1.481e-2430.09Leucoanthocyanidin dioxygenase OS=Arabidopsis thal... [more]
LDOX_VITVI1.811e-2229.49Leucoanthocyanidin dioxygenase OS=Vitis vinifera P... [more]
FNSI_PETCR5.269e-2226.00Flavone synthase OS=Petroselinum crispum GN=FNSI P... [more]
LDOX_MALDO1.174e-2127.88Leucoanthocyanidin dioxygenase OS=Malus domestica ... [more]
LDOX_PERFR3.415e-2126.20Leucoanthocyanidin dioxygenase OS=Perilla frutesce... [more]
GAOX1_ARATH5.826e-2127.35Gibberellin 20 oxidase 1 OS=Arabidopsis thaliana G... [more]
LDOX_PETHY7.608e-2127.56Leucoanthocyanidin dioxygenase OS=Petunia hybrida ... [more]
FLS1_ARATH9.937e-2129.09Flavonol synthase/flavanone 3-hydroxylase OS=Arabi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34109C08EF PostHarvP1 Citrus clementina cDNA clone C34109C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930811 ID=FC930811|Name=FC930811|organism=Citrus clementina|type=EST|length=744bp
AATACAAAGCTGCAGCAATCTTGAAAGGATTTGAGGAACAAAAGATGGCC
CAGATTGGAAGTTCTCTCCTTGTGCCTTGTGTTCAAGAGTTGGTCAAGAA
TCCTGCGTTAGTTGTCCCCGACAGATACATACGTCCAGATCAAGATTCAC
CACTCATTTCTGATGATACTTTGATTTCACAGATACCAGTTATTGACATG
CAAAGCTTACTTTCTGAAGAATCAATGGATTCTGAGCTAGCCAAGCTCGA
CTTCACATGCAAAGAATGGGGTTTTTTCCAGCTGGTAAATCATGGAATGA
GCACAGCATTTCTAGAGAAATTAAAGAAAGAGGTTGAGGGATTCTTCAAT
CTCAGCATGGAAGAAAAGAAAAAATATTGGCAGCATCCAGGAGATATGGA
AGGCTTTGGACAAGCCTTTGTTGTATCTGAGGAACAAAAGCTTGATTGGG
CTGACCTTTTCTCCATGCTGACTCTTCCAGTTCATCTGAGGAAGCCACAC
TTATTTCCTAAGCTCCCTCCTTCCCTCAGAGAGACCTTGGAAGTTTACTC
AATGGAATTAAAATCCCTAGCCGAGAACCTAATATCGAANATGGGAGAAG
TGTTAAATATCAAAGATGAAGAAATGAGAGAATTCTTTGAAAAATGGAGT
GCAGCAATGAGGATGAATTATTACCCTCCATGTCCTCAGCCCGAGAAGGN
TATGGGCCTGTCGCCACATCTGATGCAGCTGCACTTACCATCTG
back to top