FC930819

Overview
NameFC930819
Unique NameFC930819
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
PostHarvP1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15220 contig Ccv1_Contig15220:1..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_TOBAC (Isocitrate dehydrogenase [NADP] OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 444.506 bits (1142), Expect = 2.521e-124
Identity = 214/229 (93.45%), Postives = 223/229 (97.38%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHGSKMTREHYLNTEEFIDAVADDLRA 689
            VALSMYNTDES+R+FAEASMN AYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSK+E AGIWYEHRLIDDM AYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAW+RGLAHRA LDNN RLLDFTEKLEAACIG VESGKMTKDLALIIHGSK++R+HYLNTEEFIDAVAD+L+A
Sbjct:  180 VALSMYNTDESVRSFAEASMNMAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKYEEAGIWYEHRLIDDMAAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLALIIHGSKLSRDHYLNTEEFIDAVADELKA 408          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_SOLTU (Isocitrate dehydrogenase [NADP] OS=Solanum tuberosum GN=ICDH-1 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.787e-123
Identity = 215/230 (93.48%), Postives = 224/230 (97.39%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLAL-IIHGSKMTREHYLNTEEFIDAVADDLRA 689
            VALSMYNTDES+R+FAEASMN A+QKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSK+E AGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAW+RGLAHRA LDNN RLLDFTEKLEAACIG VESGKMTKDLAL IIHGSK++REHYLNTEEFIDAVAD+L+A
Sbjct:  180 VALSMYNTDESVRSFAEASMNMAFQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKYEEAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRATLDNNERLLDFTEKLEAACIGAVESGKMTKDLALIIIHGSKLSREHYLNTEEFIDAVADELKA 409          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_SOYBN (Isocitrate dehydrogenase [NADP] OS=Glycine max GN=IDH1 PE=2 SV=2)

HSP 1 Score: 434.876 bits (1117), Expect = 1.997e-121
Identity = 210/229 (91.70%), Postives = 224/229 (97.82%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHGSKMTREHYLNTEEFIDAVADDLRA 689
            V+L+MYNTDESIR+FAEASM TA +KKWPLYLSTKNTILKKYDGRFKDIFQEVYEA+WKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRH+RVHQKGGETSTNSIASIFAW+RGLAHRAKLD+NA+LLDFTEKLEAACIG VE+GKMTKDLALI+HGSK++REHYLNTEEFIDAVA +L A
Sbjct:  181 VSLAMYNTDESIRSFAEASMATALEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEASWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNAKLLDFTEKLEAACIGVVEAGKMTKDLALILHGSKLSREHYLNTEEFIDAVAAELSA 409          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHP_MEDSA (Isocitrate dehydrogenase [NADP], chloroplastic (Fragment) OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 1.295e-120
Identity = 209/228 (91.67%), Postives = 221/228 (96.93%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHGSKMTREHYLNTEEFIDAVADDLR 686
            VAL+MYNTDESIR+FAEASM  A +KKWPLYLSTKNTILKKYDGRFKDIFQEVYEA WKSK+EAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRH+RVHQKGGETSTNSIASIFAW+RGLAHRAKLD+NA LLDFTEKLEAACIG VESGKMTKDLALI+HGSK++REHYLNTEEFIDAVA +L+
Sbjct:  201 VALAMYNTDESIRSFAEASMAVALEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKYEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHFRVHQKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVESGKMTKDLALILHGSKLSREHYLNTEEFIDAVAAELK 428          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_RAT (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rattus norvegicus GN=Idh1 PE=1 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.948e-92
Identity = 164/230 (71.30%), Postives = 188/230 (81.74%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHG-SKMTREHYLNTEEFIDAVADDLRA 689
            VA+ MYN D+SI  FA +S   A  K WPLYLSTKNTILKKYDGRFKDIFQE+Y+  +KSKFEA  IWYEHRLIDDMVA A+KSEGG++WACKNYDGDVQSD +AQG+GSLG+MTSVL+CPDGKT+EAEAAHGTVTRHYR++QKG ETSTN IASIFAWSRGLAHRAKLDNN  L  F   LE  CI T+E+G MTKDLA  I G   + R  YLNT EF+D + ++L+A
Sbjct:  178 VAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSKFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFANALEEVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKA 407          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_MICOH (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus ochrogaster GN=IDH1 PE=3 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.948e-92
Identity = 163/230 (70.87%), Postives = 189/230 (82.17%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHG-SKMTREHYLNTEEFIDAVADDLRA 689
            VA+ MYN D+SI  FA +S   A  K WPLYLSTKNTILKKYDGRFKDIFQE+Y+  +KS+FEA  IWYEHRLIDDMVA A+KSEGG++WACKNYDGDVQSD +AQG+GSLG+MTSVL+CPDGKT+EAEAAHGTVTRHYR+HQKG ETSTN IASIFAWSRGLAHRA+LDNN  L  F + LE  CI T+E+G MTKDLA  I G   + R  YLNT EF+D + ++L+A
Sbjct:  178 VAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMHQKGQETSTNPIASIFAWSRGLAHRARLDNNTELSFFAKALEEVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKA 407          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_MICME (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Microtus mexicanus GN=IDH1 PE=2 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 1.948e-92
Identity = 163/230 (70.87%), Postives = 189/230 (82.17%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHG-SKMTREHYLNTEEFIDAVADDLRA 689
            VA+ MYN D+SI  FA +S   A  K WPLYLSTKNTILKKYDGRFKDIFQE+Y+  +KS+FEA  IWYEHRLIDDMVA A+KSEGG++WACKNYDGDVQSD +AQG+GSLG+MTSVL+CPDGKT+EAEAAHGTVTRHYR+HQKG ETSTN IASIFAWSRGLAHRA+LDNN  L  F + LE  CI T+E+G MTKDLA  I G   + R  YLNT EF+D + ++L+A
Sbjct:  178 VAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMHQKGQETSTNPIASIFAWSRGLAHRARLDNNTELSFFAKALEEVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKA 407          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_SHEEP (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Ovis aries GN=IDH1 PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.674e-91
Identity = 161/229 (70.31%), Postives = 188/229 (82.10%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHG-SKMTREHYLNTEEFIDAVADDLR 686
            VA+ M+N D+SI  FA +S   A  K WPLYLSTKNTILKKYDGRFKDIFQE+Y+  +KS+FEA  IWYEHRLIDDMVA A+KSEGG++WACKNYDGDVQSD +AQG+GSLG+MTSVLVCPDGKT+EAEAAHGTVTRHYR++QKG ETSTN IASIFAW+RGLAHRAKLDNN  L  F + LE  CI T+E+G MTKDLA  I G   + R  YLNT EF+D + ++L+
Sbjct:  178 VAMGMFNQDKSIEDFAHSSFQMALSKNWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALEEVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLQ 406          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHC_BOVIN (Isocitrate dehydrogenase [NADP] cytoplasmic OS=Bos taurus GN=IDH1 PE=2 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 6.266e-91
Identity = 161/229 (70.31%), Postives = 187/229 (81.66%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHG-SKMTREHYLNTEEFIDAVADDLR 686
            VA+ MYN D+SI  FA +S   A  K WPLYLSTKNTILKKYDGRFKDIFQE+Y+  +KS+FEA  IWYEHRLIDDMVA A+KSEGG++WACKNYDGDVQSD +AQG+GSLG+MTSVLVCPDGKT+EAEAAHGTVTRHYR++QKG ET TN IASIFAW+RGLAHRAKLDNN  L  F + LE  CI T+E+G MTKDLA  I G   + R  YLNT EF+D + ++L+
Sbjct:  178 VAMGMYNQDKSIEDFAHSSFQMALSKNWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSEFEAQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETLTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALEEVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLQ 406          
BLAST of FC930819 vs. ExPASy Swiss-Prot
Match: IDHP_PIG (Isocitrate dehydrogenase [NADP], mitochondrial (Fragment) OS=Sus scrofa GN=IDH2 PE=1 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.069e-90
Identity = 161/229 (70.31%), Postives = 181/229 (79.04%), Query Frame = 3
Query:    3 VALSMYNTDESIRAFAEASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYEANWKSKFEAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWSRGLAHRAKLDNNARLLDFTEKLEAACIGTVESGKMTKDLALIIHGSKMTR--EHYLNTEEFIDAVADDL 683
            V + MYNTDESI  FA +    A QKKWPLY+STKNTILK YDGRFKDIFQE++E ++K+ F+   IWYEHRLIDDMVA  LKS GG+VWACKNYDGDVQSD LAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYR HQKG  TSTN IASIFAW+RGL HR KLD N  L+ F + LE  C+ TVESG MTKDLA  IHG    +  EH+LNT +F+D +  +L
Sbjct:  186 VGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDKYKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTSDFLDTIKSNL 414          
The following BLAST results are available for this feature:
BLAST of FC930819 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
IDHC_TOBAC2.521e-12493.45Isocitrate dehydrogenase [NADP] OS=Nicotiana tabac... [more]
IDHC_SOLTU2.787e-12393.48Isocitrate dehydrogenase [NADP] OS=Solanum tuberos... [more]
IDHC_SOYBN1.997e-12191.70Isocitrate dehydrogenase [NADP] OS=Glycine max GN=... [more]
IDHP_MEDSA1.295e-12091.67Isocitrate dehydrogenase [NADP], chloroplastic (Fr... [more]
IDHC_RAT1.948e-9271.30Isocitrate dehydrogenase [NADP] cytoplasmic OS=Rat... [more]
IDHC_MICOH1.948e-9270.87Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mic... [more]
IDHC_MICME1.948e-9270.87Isocitrate dehydrogenase [NADP] cytoplasmic OS=Mic... [more]
IDHC_SHEEP3.674e-9170.31Isocitrate dehydrogenase [NADP] cytoplasmic OS=Ovi... [more]
IDHC_BOVIN6.266e-9170.31Isocitrate dehydrogenase [NADP] cytoplasmic OS=Bos... [more]
IDHP_PIG1.069e-9070.31Isocitrate dehydrogenase [NADP], mitochondrial (Fr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC34109D04EF PostHarvP1 Citrus clementina cDNA clone C34109D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC930819 ID=FC930819|Name=FC930819|organism=Citrus clementina|type=EST|length=700bp
GAGTTGCATTGTCCATGTATAACACTGATGAGTCCATCCGAGCTTTTGCT
GAGGCTTCTATGAACACTGCCTATCAGAAGAAGTGGCCACTCTATCTTAG
TACAAAAAACACTATCCTTAAGAAGTATGATGGAAGATTCAAAGACATAT
TTCAAGAGGTTTATGAGGCAAACTGGAAGTCAAAGTTTGAAGCTGCTGGC
ATATGGTATGAACATCGTCTCATTGATGATATGGTAGCTTATGCTCTCAA
AAGTGAAGGAGGTTATGTGTGGGCTTGCAAAAATTATGATGGAGATGTCC
AGAGTGATTTCCTAGCTCAAGGGTTTGGATCTCTTGGATTGATGACATCT
GTACTGGTATGCCCTGATGGGAAGACAATTGAAGCCGAAGCAGCCCATGG
AACAGTTACCCGACACTACAGAGTTCATCAGAAAGGTGGTGAAACTAGCA
CAAACAGCATAGCCTCCATCTTTGCTTGGTCACGAGGGCTTGCACATAGG
GCGAAGTTGGACAACAATGCTAGGCTATTGGATTTTACTGAGAAACTAGA
AGCTGCATGTATTGGCACTGTTGAATCTGGGAAGATGACCAAGGATCTTG
CACTTATTATCCATGGATCTAAGATGACTAGGGAACACTATCTGAATACT
GAAGAGTTCATTGATGCTGTGGCCGACGATCTAAGAGCAGACTCTCTGGC
back to top